CAZyme Information: MGYG000003133_01043

Basic Information

• Species: Niallia sp900199695
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Niallia; Niallia sp900199695
• CAZyme ID: MGYG000003133_01043
• CAZy Family: GT2
• CAZyme Description: Teichoic acid poly(glycerol phosphate) polymerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
706	MGYG000003133_9|CGC1	83756.87	9.2253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003133	3790105	MAG	United States	North America

• Gene Location: Start: 49930; End: 52050 Strand: -

Full Sequence      

MSESGFNHKQIQTISIIHNILRFQFGFKTSILEDNKASFLILNRKTESEKYVPFHTIEDE
NTVGSYEVKIDLHKEIGFFGQPGVWDIYVVVESEDDEYKRYRLVSNRQELNLIYYNYADM
GTVFYPYTTNKMNVSLKTTKKPFIAKVEDAFLEKDGSLNISGYVLNTNLTVSNKEINKTL
IITNHLDEEQYRLPLENIKRTDLTELYGDGIRNYDEIGFKGTIDLKNYLHTSELLYFRFY
IELSSIENGEEVVTVSPRLTFNPFNPLHSRRAKVIKIDGIDRRIFIKKTKVKSYLSVKVY
VYNRSKEWKSRIRRKMTDIKRSRKIKILYKKVFKLLGYAPVRKKSVVFESFAGRQFSCNP
RAIFEYMKEYNPEYKMYWSVDKKYMKNFEGRNLNIVPRFSIKWLFIMARAQYWVSNSRLP
LWIPKPKHTTYLQTWHGTPLKKLAADMDEVHMPGTNTVKYKNNFLKEASNWDYLISPNAY
STEIFKRAFDFNKTMIESGYPRNDVLHVDNTKENIEALKQKFALPMDKKVILYAPTWRDN
QFYGRGKYKFDLELDLNMLREQLGEEYIVLLRMHYLVAENFDLTPYTGFAFDFSNYEDIR
ELYLASDILVTDYSSVFFDYANLRRPMIFFVYDIEDYRDNLRGFYFDFEKTAPGPLVKTT
EEVIESIRDAEVSPISDKFNDFYDKFCYLEAGKSAERVVEEVFNKR

Enzyme Prediction     

No EC number prediction in MGYG000003133_01043.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	1.15e-142	340	704	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	5.45e-111	325	706	8	388	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJI06556.1	1.09e-140	256	703	263	709
AIY76015.1	1.09e-140	256	703	263	709
ARO20908.1	1.09e-140	256	703	263	709
QHS23522.1	2.16e-140	185	704	193	710
QTN00810.1	3.62e-140	340	705	375	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	8.36e-111	341	698	350	710	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	8.93e-110	341	698	350	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	2.46e-109	341	698	350	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	3.37e-204	32	703	59	743	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	2.69e-175	328	702	16	392	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q2G1C1	1.04e-115	333	703	18	388	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q5HLM5	3.74e-110	341	698	350	710	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKJ2	1.15e-33	332	702	249	603	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003133_01043.