CAZyme Information: MGYG000003133_01766

Basic Information

• Species: Niallia sp900199695
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Niallia; Niallia sp900199695
• CAZyme ID: MGYG000003133_01766
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
872		100473.9	6.461

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003133	3790105	MAG	United States	North America

• Gene Location: Start: 52722; End: 55340 Strand: -

Full Sequence      

MKWLKRNIINDFLEAVSNNEKKDKSATINISLFSKEISVKFHVDNLVGILNGAKNNKVLA
LPSPQEDNSSLEEIATPNSVVSENDPETLGSNSQSAEEKARKEAAAQEKARKEAAAQEKA
RKEAAAQEKARKEAAAQEKARKEAAAQEKARQEAAAQEKARQEAAAQEKAKQKAAAQEKA
RQEAAAQEKAKQEAAAQEKARQKAVAQEKARKEVTAQEKAKKEALTMTKVETKLSPKEPI
ASTNQNFCVIAGKEYCMKIMAFYESLVKNSNNFNLWVCCTDAITYKFLNEKNLKNMHLIR
VEEIEDDQLRAVKQERMINEYCWTLKSFVIEYILKNNDVEQVLYCDGDIYFFSNPDSIFN
EWGSASIFLTPQRDLDWVEQKYGKYQAGIVGFRKDETGLAAVQWWKDRCIEWCSVVESNG
RFGDQKYLDQLPIMYENVQISSNLGVNAAPWNIIYNNNFKISLQGDKVFINNDPLVAYHF
SCLTIYSSDKYDLWNMHQLNIQKEIMNYIYVPYLDHLERVITSYQNSYPGIIKATLSTND
FIQAKTKYHSTKLKRKMIKYNNYLLLTSIFSKEYLVKGLAMYDSLSKQIENFHLWICTMD
QETYDVLSNLNLKNVTLIPVETIETPQLKELKQQRTLQEYCWTIKATLLEHLLSTHSDID
HLFYCDSDLYFFSNPLSVTNDFGRYSVYLCRQRGTDLLEHFHGQYQAGFIGFKNEGNSRK
ILNWWKKKCLEECSDVYNDERKSWGDQLYLDRIPELFENIKVSENPGINAAPWNLILNNA
EQEVTMRENNVYIDNNPLMFFHFGSLLILNVNEFDLWKLEEVNISSAILTNIYNPYLMKL
REISNRLSNNAQFFANVPADYTAKNPYSIASL

Enzyme Prediction     

No EC number prediction in MGYG000003133_01766.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02794	tolA_full	2.26e-25	94	224	84	209	TolA protein. TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cutoffs are based largely conserved operon struction. //The Tol-Pal complex is required for maintaining outer membrane integrity. Also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins ompC, phoE and lamB. [Transport and binding proteins, Other, Cellular processes, Pathogenesis]
PRK09510	tolA	1.88e-24	94	224	87	229	cell envelope integrity inner membrane protein TolA; Provisional
PRK09510	tolA	9.23e-24	96	224	120	245	cell envelope integrity inner membrane protein TolA; Provisional
TIGR02794	tolA_full	2.10e-23	96	220	106	233	TolA protein. TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cutoffs are based largely conserved operon struction. //The Tol-Pal complex is required for maintaining outer membrane integrity. Also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins ompC, phoE and lamB. [Transport and binding proteins, Other, Cellular processes, Pathogenesis]
PRK09510	tolA	5.53e-23	17	224	5	215	cell envelope integrity inner membrane protein TolA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJX61468.1	0.0	1	872	1	1042
QKH60623.1	0.0	231	872	615	1256
QWG31434.1	8.03e-235	243	849	51	656
AKE17841.1	5.96e-233	244	871	55	685
QBZ26486.1	5.96e-233	244	871	55	685

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31542	1.64e-48	567	856	7	294	Uncharacterized protein YfnD OS=Bacillus subtilis (strain 168) OX=224308 GN=yfnD PE=4 SV=1
O06484	4.75e-43	568	813	7	256	Uncharacterized protein YfnF OS=Bacillus subtilis (strain 168) OX=224308 GN=yfnF PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003133_01766.