CAZyme Information: MGYG000003133_02288

Basic Information

• Species: Niallia sp900199695
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Niallia; Niallia sp900199695
• CAZyme ID: MGYG000003133_02288
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442	MGYG000003133_33|CGC1	50020.38	5.1432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003133	3790105	MAG	United States	North America

• Gene Location: Start: 2446; End: 3774 Strand: -

Full Sequence      

MSKITFLGAGSTVFAKNVLGDCMFVDALDGFEFALFDIDEQRLRDSEQMLNNLKESLGKN
IQIKAYTDRRESLREAKYVINAIQVGGYKPSTVIDFEIPKKYGLRQTIADTVGIGGIFRN
LRTIPVMLDFAKDMEEVCPDALFMNYTNPMAVLTGVMNRYTNIKTVGLCHSVQVCTKDLF
DALGMDRTGVKEKIAGINHMAWLLEVSKDGVDLYPEIKRRARELQKTKHGDMVRFELMDK
FGYYVTESSEHNAEYHPYFIKSRYPELIERFNIPLDEYPSRCEKQINNWIAMREDLVNNK
SLDHVCSHEYGSRIIEAMETNVPFKFGGNVLNTGRLISNLPEKACVEVPCIADRSGITPT
YVGDLPEQLAALNRTNINTQLLTIEAAITLKKEFIYQAAMLDPHTAAELSMDDIISLCDD
LIEAHGDWLPNFKSETSIAVTK

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	3	181	6.6e-68	0.9832402234636871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	0.0	3	422	2	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
PRK15076	PRK15076	0.0	1	433	1	431	alpha-galactosidase; Provisional
COG1486	CelF	2.68e-177	3	433	5	440	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
pfam02056	Glyco_hydro_4	3.52e-76	3	185	1	183	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	1.44e-66	3	429	2	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA76083.1	1.10e-312	1	441	1	441
QKH61466.1	1.60e-305	1	442	1	442
QJX62287.1	5.34e-304	1	442	1	442
AYV74672.1	8.85e-303	1	442	1	442
QWH41656.1	3.82e-281	1	439	1	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	2.12e-36	3	423	7	437	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	1.91e-35	3	432	6	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	1.17e-32	3	432	9	440	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1U8X_X	2.85e-22	3	439	30	472	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
1OBB_A	1.78e-21	3	415	5	461	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34645	1.18e-248	1	433	1	432	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
P06720	4.87e-139	3	432	6	448	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
P30877	4.50e-137	3	430	6	446	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
Q9X4Y0	1.01e-67	3	432	5	442	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
Q9AI65	4.12e-44	2	433	3	453	Alpha-glucosidase OS=Erwinia rhapontici OX=55212 GN=palH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003133_02288.