CAZyme Information: MGYG000003136_00850

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus
• CAZyme ID: MGYG000003136_00850
• CAZy Family: GT8
• CAZyme Description: Glycosyltransferase-stabilizing protein Gtf2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445		51105.8	4.6491

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003136	1781350	MAG	United States	North America

• Gene Location: Start: 8790; End: 10127 Strand: -

Full Sequence      

MIELYDRYSQESRDLHESLVATGLSQLGVVIDADGFLPDGLVSPFTYYLGYEDGKPLYFN
QVPVPAFWEISGNNQSAHIEDMTQERAVIHYADGMQARLVKQVDWKDLEGKVRQVDYYNR
YGACFATTTYSADSERIMTVYQDVNGQQVLLENHVTGDILLTLPGQPMHYFANKVEFIIF
FLQDLEIDTSQLIFNTLATPFLVSFHHPDKSGSDVLVWQEPLYDAIPGNMQLILESDDVR
TKKIIIPNKATYERALELTDEKYHTQFVHLGYHYQFKRDNFLRRDVLILTNSDQIEQVEA
IVEALPDVTFRIAAVTEMSSKLLDMLRYPNVVLYQNASPQKIQELYQLSDIYLDINHSNE
LLHAVRQAFEHNLLILGFHQTVHNRLYIAPDHLFESSEVAPLVETIKLALSDVDQMRQAL
GKQGQHANYVDLVRYQETMQTVLGG

Enzyme Prediction     

No EC number prediction in MGYG000003136_00850.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02919	TIGR02919	0.0	1	439	1	438	accessory Sec system glycosyltransferase GtfB. Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. [Protein fate, Protein modification and repair]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKL33658.1	1.69e-313	1	445	1	445
AMH89202.1	1.14e-311	1	445	1	445
VGM73407.1	1.49e-307	1	445	1	445
VFI20341.1	1.49e-307	1	445	1	445
ARD37530.1	3.00e-307	1	445	1	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E9T_B	1.26e-174	2	445	2	447	Crystalstructure of GtfA/B complex [Streptococcus gordonii],5E9T_D Crystal structure of GtfA/B complex [Streptococcus gordonii]
5E9U_B	9.90e-174	2	444	2	446	Crystalstructure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_D Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_F Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_H Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii]
5GVW_A	1.65e-13	289	407	283	402	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVV_A	5.22e-12	289	407	283	402	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2UR90	5.74e-306	1	445	1	445	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtfB PE=1 SV=1
Q79T00	4.61e-180	1	445	1	447	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus gordonii OX=1302 GN=gtfB PE=1 SV=1
A1C3M0	4.86e-107	1	415	1	413	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus parasanguinis OX=1318 GN=gtfB PE=1 SV=1
Q3S2Y1	1.08e-103	1	445	1	438	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus agalactiae OX=1311 GN=gtfB PE=1 SV=1
A0A0S4NND9	1.08e-84	1	436	1	432	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtfB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003136_00850.