CAZyme Information: MGYG000003137_00396

Basic Information

• Species: Bradyrhizobium sp000015165
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp000015165
• CAZyme ID: MGYG000003137_00396
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000003137_1|CGC1	37342.94	8.9773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003137	8388709	MAG	United States	North America

• Gene Location: Start: 457884; End: 458870 Strand: -

Full Sequence      

MTDPAPRTFGVVAIGRNEGERLKRCLTSINGAARIVYVDSGSTDGSVAWAEQAGIDVVAL
DMSLPFTAARARNAGMRRLRQLAPEIDLVQFVDGDCELQQDWPAIAITYLVEHPQVCATF
GRRRERFPERSIYNLICDREWDTPVGEAKACGGDVMMRVDALEAAGGYRDDLIAGEEPEL
CVRLRAGGWKIWRLDHDMTLHDAAMHHFSQWWRRQARSGYAFAQGAHLHGRTDERHWVWE
SRRALLWAILIPSAILAGLLLAGPLALLVLLIYPAQVLRRSRRMSGRWRTRLQLAFFEQL
SRFPEAWGQLLFFRNRLLGRHGRLIEYK

Enzyme Prediction     

No EC number prediction in MGYG000003137_00396.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	2.33e-15	11	208	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	5.03e-13	16	194	6	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG1216	GT2	2.46e-11	9	208	5	220	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	4.73e-11	17	162	8	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02522	GT_2_like_a	1.32e-10	17	191	9	177	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ33261.1	6.77e-247	1	328	1	328
QHO78434.1	2.11e-151	9	328	9	328
SHH49097.1	4.70e-142	9	328	14	333
QOZ59553.1	7.24e-140	9	328	18	337
QAU38494.1	7.24e-140	9	328	18	337

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33691	8.49e-06	20	195	29	210	Succinoglycan biosynthesis protein ExoA OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
251	273