CAZyme Information: MGYG000003137_04535

Basic Information

• Species: Bradyrhizobium sp000015165
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp000015165
• CAZyme ID: MGYG000003137_04535
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444	MGYG000003137_22|CGC1	48196.38	8.5629

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003137	8388709	MAG	United States	North America

• Gene Location: Start: 23895; End: 25229 Strand: +

Full Sequence      

MHTKSPAARRDDDDGADEAVPEGVPAVRRCALTALLIFAITHVLLMVGVAAPSKFVFDEV
HYVPAARQMLGLAPAAPQLNPMHPPLAKELIALSIRTFGDNAFAWRYPGTVLGALAVVAI
YLCGLALFAAQPAALAAALLALVNQMLFVQARAAMLDIGALAFSLLGIAAFLFAYGQRRP
QLLFALAGALFGVAVACKWSGLFPLLTVLGIVGVIKLLQHWQTAFGDPQPTDWYRPEQWP
ELRGWHILLCLVAIPALCYLATFVPLHGMSIPGIFDAQRRIFADSITTAIAGHTYMSAWP
TWPLLMRPVWFLFDKAGDSDIAAVVLLGNPLVLWPALVALAVCARDVVAARSAPAFLILA
FYLGCYLPWALLPRALSFLYYYLPSATLTSLALVHALTRLPRWAMWAYVAVATIGFLVML
PISAAFIGTTMQGFSRLMLFQSWI

Enzyme Prediction     

No EC number prediction in MGYG000003137_04535.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	37	265	9.8e-50	0.9820627802690582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	1.58e-12	32	278	25	280	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	3.88e-10	293	440	21	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG4346	COG4346	6.31e-09	79	213	132	259	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	1.08e-08	292	444	518	694	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	3.06e-07	52	263	18	237	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ34386.1	1.63e-315	1	444	1	444
BAM91644.1	1.62e-260	1	444	1	444
SMX60211.1	4.44e-251	1	444	1	444
CAL75759.1	2.39e-249	4	444	17	457
QOZ48998.1	1.69e-196	22	444	10	433

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	9.86e-17	31	380	39	441	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	7.49e-15	56	380	72	447	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	7.49e-15	56	380	72	447	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	2.54e-08	56	380	63	445	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999988	0.000044	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
30	52
103	125
127	149
153	175
182	215
244	266
287	306
321	343
350	372
376	398
405	427