CAZyme Information: MGYG000003137_04716

Basic Information

• Species: Bradyrhizobium sp000015165
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp000015165
• CAZyme ID: MGYG000003137_04716
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	MGYG000003137_23|CGC1	41443.05	10.008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003137	8388709	MAG	United States	North America

• Gene Location: Start: 77480; End: 78697 Strand: -

Full Sequence      

MIVSGKAVIRIVLGVVAVAVTAVALIFVFDPAINFDFPPSAREKTAAGAGAPAQSGSGGV
AVQTPGAQDQDRAASPLAKMQQQAGGLADVLSPLVPQPSADSDLPAFDVVNVDPSGDAVV
AGRATPGAAVELLRNGEVHDRTVADRSGQFAMVPRRLPAGTYDLTLRAKLADGRELSSKQ
SVAVIVEAGRQPATVALLAPGEPTRVLSKPSGSIPQALAVDAVDVEPSGILRVSGRARPG
ATVRLYLNDRLISSATAAADGRLNITIGKDVARASNDRIRLDEVDPKSGSVQARAEVPLS
LPEDSTTASLPSAAGAAGKANGSPAAQRTALAAAGGSQDTVAHAGGGEPKMITVTVARGD
SLWHISRRLLGGGTRYAVIYKANREQIRSPDLIYPGQVFLLPAKR

Enzyme Prediction     

No EC number prediction in MGYG000003137_04716.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	3.86e-13	346	403	90	147	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	9.06e-09	352	398	1	42	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
COG1652	XkdP	1.58e-07	353	404	212	264	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
pfam01476	LysM	1.41e-06	354	402	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
NF033163	lipo_LipL71	3.40e-06	360	405	416	463	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ36024.1	7.06e-272	1	405	1	405
SMX58743.1	7.40e-175	1	404	1	409
BAM89674.1	2.05e-140	72	405	70	400
SMX58749.1	1.42e-135	77	405	87	410
SHI17277.1	7.80e-112	17	404	14	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FIM_A	2.63e-07	355	404	100	149	Thestructure of Kbp.K from E. coli [Escherichia coli],7PVC_A Chain A, Potassium binding protein Kbp [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0ADE6	1.25e-06	355	404	100	149	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2
P0ADE7	1.25e-06	355	404	100	149	Potassium binding protein Kbp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=kbp PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999990	0.000032	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
7	29