CAZyme Information: MGYG000003137_05389

Basic Information

• Species: Bradyrhizobium sp000015165
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp000015165
• CAZyme ID: MGYG000003137_05389
• CAZy Family: GT1
• CAZyme Description: 4'-demethylrebeccamycin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	MGYG000003137_29|CGC2	49080.45	7.2232

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003137	8388709	MAG	United States	North America

• Gene Location: Start: 87460; End: 88830 Strand: -

Full Sequence      

MARFLIAATALPGHVFPLLAVSQLLVSRGHEVVVNTGSLFRERVEATGARFVAFRPEIDH
DYRKLDEHFPERRKIAPGPALLSFGLKHIFADAIPHQAAGIRDLHREFPFDAIITDTMFC
GTFPLLLGPPEKRVPIIGLGITALALSSADTAFFGTALPPSITPADRARNAAMNSHLQKV
MFGPVQQYFNDVLVRIGARPLPAFLFDSMITLPDLYLQLTAWEFEYPRGTMPSSIRFVGP
LLPPPSTGFRPPPWWDEIDNAGPIVLVTQGTLANEDLGQLVGPTLRGLANEDLTVIACTG
GPPTESIPVVVPPNARAATFLPFDRLLPKVSVMVTNGGYGGVNHALSLGVPLVVAGDSEE
KPEIAARVAWAGAGINLGTGRPSASQIREAVRAVLTTPQYRQRAQALRAAFASYNARNEI
AERVEQLAATGLPASSQGDPPRRFDLVGTPAEPASR

Enzyme Prediction     

No EC number prediction in MGYG000003137_05389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	29	429	3.1e-45	0.9554973821989529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	5.44e-53	1	431	1	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	4.60e-43	2	427	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
TIGR01426	MGT	2.14e-30	13	429	7	391	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam00201	UDPGT	1.05e-10	14	407	12	418	UDP-glucoronosyl and UDP-glucosyl transferase.
cd03785	GT28_MurG	3.00e-04	3	422	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ36175.1	0.0	1	456	1	456
SHH83627.1	1.03e-257	1	456	1	456
SHL67027.1	6.87e-256	1	456	1	456
SHG59197.1	5.35e-253	1	456	1	456
BBA33608.1	8.44e-225	1	431	1	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IYA_A	5.89e-16	13	408	24	400	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
3RSC_A	3.17e-11	2	408	21	392	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3RSC_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
3IAA_A	3.18e-11	2	408	21	392	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora],3IAA_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora]
6PNT_A	3.39e-11	3	428	14	432	StructuralCharacterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
3OTG_A	5.41e-10	252	420	232	399	CrystalStructure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form [Micromonospora echinospora],3OTH_A Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora],3OTH_B Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8KHE4	1.81e-93	2	427	3	420	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
E7CQW6	2.98e-67	5	429	9	436	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
E9L011	1.55e-60	8	429	12	432	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
J4VV61	1.92e-56	6	429	21	459	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
Q6K1J1	1.29e-10	106	407	142	446	UDP-glucuronosyltransferase 2B31 OS=Canis lupus familiaris OX=9615 GN=UGT2B31 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.987819	0.011877	0.000252	0.000023	0.000014	0.000025

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003137_05389.