CAZyme Information: MGYG000003137_05474

Basic Information

• Species: Bradyrhizobium sp000015165
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp000015165
• CAZyme ID: MGYG000003137_05474
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277		29090.14	9.4537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003137	8388709	MAG	United States	North America

• Gene Location: Start: 70739; End: 71572 Strand: -

Full Sequence      

MKRLVLTAWIAGLAMAGHLPAAMAAEDLAAEDAAPASAAKAKIGKTGAKASTAVRLAHVR
PDGIKELAAHSAVTKAAREVEAIEAVSGADNSQPVDANAAAPAAEAEAVPVDTPAAEPRE
TDRKAADVKPKHMNTGHPHIDALVAVHAAANDVPEALIHRVIVRESKYQKDLVGRCGCIG
LMQIKLGTARGLGYTGDAAGLHDPNTNLTYGVKYLAGAYRAARGDHDRAVAYFAKGYYEE
AKRQRLADARPFARPERVAAPLDITPKITPVRHARAH

Enzyme Prediction     

No EC number prediction in MGYG000003137_05474.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	7.97e-15	155	234	1	80	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.84e-13	141	254	140	258	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd13401	Slt70-like	2.28e-11	138	216	5	87	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.01e-10	147	232	11	101	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.34e-09	148	231	5	90	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ38144.1	1.03e-179	1	277	1	277
BAM87915.1	1.00e-140	6	277	2	267
SMX60465.1	4.67e-130	1	277	1	268
CAL79377.1	2.02e-122	1	277	1	260
SDS90419.1	1.80e-51	137	264	27	153

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000303	0.999006	0.000198	0.000183	0.000159	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003137_05474.