CAZyme Information: MGYG000003137_06583

Basic Information

• Species: Bradyrhizobium sp000015165
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp000015165
• CAZyme ID: MGYG000003137_06583
• CAZy Family: GH15
• CAZyme Description: Glucoamylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768	MGYG000003137_46|CGC1	84940.94	5.9452

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003137	8388709	MAG	United States	North America

• Gene Location: Start: 26795; End: 29101 Strand: +

Full Sequence      

MVGCSLGPARLWFTAGYGIINEVYWPRIDIPQIRDLGFILADDQGFWVEVKRMGQYQLRS
VAPGVPAYEITHSHSRFSLRLRITPDPLRDVLVIECRLESDDPALRIYVLVAPHLGATGY
GNRAVIAEHRGRRFLSAERAPFAMALAAVDEHQQDAVMRASAGYVGTSDGWQDFARNGRM
AWEYPAAGPGNVALLAELRPFSVLALAFASSQSAAATLAVSSLMQPFDRVMDAQIADWSA
WHRSCDECCARPAGVPAHLQDQFVTSVTVLRTHLDKTYPGAMVASLSVPWGDTGNERSGY
HLVWPRDLVECATALLAFGGEAEARNTLRYLIATQNVEGHWHQNQWLGGEPYWRGVQLDE
AAYPVLLAALLADRDALGGIEPHDMIRRALGYIARVGPSTDQDRWEENSGLNTFTLATCI
AALVAGGSLLEETARHWAIALADFWNAHLEDWLTASGSELARKFAVAGYYVRTSPPSVLS
DGRAALDELVPIRNHSDGAGMRANEQISTDFLRLVRFGLRDPADPFVLDTIKLVDGLLKV
ETPSGSVWHRYNGDGYGEYDDGRPYDGAGRGRPWPLLAGERGHYALSAGQDPLPMLETMA
ASASPGGMIPEQVWDASPIQERRLHPGRPTGSAMPLAWAHAEFVKLAVSRNHGRPFDRPE
AVWDRYGGRKKTSAYAFWWPHAQIRSIVAGCRLVIALPRAGMVHWGVNGWREVRDLEALD
SSLGFWVAELDTGRMNKGESIDFTIRWQEDGWERIDHRIEVVSAREDV

Enzyme Prediction     

No EC number prediction in MGYG000003137_06583.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	264	647	3.4e-90	0.9833795013850416

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01535	glucan_glucosid	0.0	9	666	1	648	glucan 1,4-alpha-glucosidase. Glucan 1,4-alpha-glucosidase catalyzes the hydrolysis of terminal 1,4-linked alpha-D-glucose residues from non-reducing ends of polysaccharides, releasing a beta-D-glucose monomer. Some forms of this enzyme can hydrolyze terminal 1,6- and 1,3-alpha-D-glucosidic bonds in polysaccharides as well. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd07430	GH15_N	2.17e-77	1	241	17	260	Glycoside hydrolase family 15, N-terminal domain. Members of this family are N-terminal domains uniquely found in bacterial and archaeal glucoamylases and glucodextranases. Glucoamylase (glucan 1,4-alpha-glucosidase; 4-alpha-D-glucan glucohydrolase; amyloglucosidase; exo-1,4-alpha-glucosidase; gamma-amylase; lysosomal alpha-glucosidase; EC 3.2.1.3) hydrolyzes beta-1,4-glucosidic linkages of starch, glycogen and malto-oligosaccharides, releasing beta-D-glucose from the non-reducing end. Glucodextranase (glucan 1,6-alpha-glucosidase; exo-1,6-alpha-glucosidase; EC 3.2.1.70) uses an inverting reaction mechanism to hydrolyze alpha-1,6-glucosidic linkages of dextran and related oligosaccharides, releasing beta-D-glucose from the non-reducing end. These N-terminal domains adopt a structure consisting of antiparallel beta-strands, divided into two beta-sheets, with one sheet wrapped by an extended polypeptide, which appears to stabilize the domain. The function of these domains in the enzymes is as yet unknown. However, it is suggested that domain N of bacterial GA is involved in folding and/or the thermostability of the A domain that forms an (alpha/alpha)6-barrel structure.
pfam09137	Glucodextran_N	5.23e-75	2	243	19	263	Glucodextranase, domain N. Members of this family, which are uniquely found in bacterial and archaeal glucoamylases and glucodextranases, adopt a structure consisting of 17 antiparallel beta-strands. These beta-strands are divided into two beta-sheets, and one of the beta-sheets is wrapped by an extended polypeptide, which appears to stabilize the domain. Members of this family are mainly concerned with catalytic activity, hydrolysing alpha-1,6-glucosidic linkages of dextran to release beta-D-glucose from the non-reducing end via an inverting reaction mechanism.
COG3387	SGA1	6.27e-64	11	651	9	605	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
pfam00723	Glyco_hydro_15	3.38e-26	266	647	10	416	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ39780.1	0.0	1	761	71	831
ACS39698.1	0.0	1	766	58	823
AER56638.1	0.0	2	761	34	793
BAV35013.1	0.0	1	746	31	774
ADE10637.1	6.40e-318	1	746	30	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UG9_A	5.15e-118	2	674	23	691	CrystalStructure of Glucodextranase from Arthrobacter globiformis I42 [Arthrobacter globiformis],1ULV_A Crystal Structure of Glucodextranase Complexed with Acarbose [Arthrobacter globiformis]
1LF6_A	1.25e-99	9	666	48	682	CRYSTALSTRUCTURE OF BACTERIAL GLUCOAMYLASE [Thermoanaerobacterium thermosaccharolyticum],1LF6_B CRYSTAL STRUCTURE OF BACTERIAL GLUCOAMYLASE [Thermoanaerobacterium thermosaccharolyticum],1LF9_A Crystal Structure Of Bacterial Glucoamylase Complexed With Acarbose [Thermoanaerobacterium thermosaccharolyticum],1LF9_B Crystal Structure Of Bacterial Glucoamylase Complexed With Acarbose [Thermoanaerobacterium thermosaccharolyticum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29761	1.07e-98	9	666	65	699	Glucoamylase OS=Clostridium sp. (strain G0005) OX=72582 GN=cga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003137_06583.