CAZyme Information: MGYG000003138_00788

Basic Information

• Species: Streptococcus pseudopneumoniae_O
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus pseudopneumoniae_O
• CAZyme ID: MGYG000003138_00788
• CAZy Family: GT113
• CAZyme Description: Glycosyltransferase stabilizing protein Gtf2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745	MGYG000003138_5|CGC2	85395.59	4.6301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003138	1796209	MAG	United States	North America

• Gene Location: Start: 91977; End: 94214 Strand: -

Full Sequence      

MKLHITNLYGMARESTATIAQNAVQKIASQLGFRELGIYFYHASAETVEERSRRLDGILA
SVSMGDVVVFQTPTWNGLEFEREFLSKLKLLNVKIIVFVHDVIPLMFKANEFLMQDYINL
YNMADSIILPSEAMKDKLLQQGLNVKKIIFQRMWDHPHDLDLHEPIFKKEIYFAGNLSRF
PELKTWEGTIPLTVFTNEEPFPLSNQVYIAGWKTDEEMLLELSKGGFGLVWTTYQNEEQN
VDYYSMNVSYKLSTYLAAGIPVIIPTTLSNSDFIVEQGLGFVVDNLKEANLLVEQLSEEA
YLQMCSRVRYFSFLLSQGFFAKQFLLQAVFEIGIKKNHALRGLQLLTVTNSQDLEQIEYL
VEHLPECDFSIVARTVMGPRLTDLAEKENVYLYPASDSEQIEKILDKADLYLDINYGGEV
DGIFNGLLEKNIPCFAFYKTQNGERGQYLFSIKNVDAMVTAIRNYAETKQLPNKPFDFEV
QTIDETLDYILEHQSSIARFGDGEAAIMLGQSINYQKYDPKLAEELKFIFNQESSPTLII
GLQEGLKNRFSFVPDALAFWRQYLEDYEEFYLDYCKNTWYGSTFISRPYIDFLDKSKAKS
QFEKLKKLWEGRDILIVEGYTSRSGVGNDLFDGAKSIKRIICPSRHAYDKKNEIMEAIIN
HADGRLVLLMLGPTAKVLAYQLAIKGMQAIDIGHVDSEYEWMQMGAENKVLLHNKHTAEF
NLDTEIELADDEAYLSQVVVDLSAE

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT101	497	719	2.1e-89	0.9955357142857143
GT113	14	328	6.1e-83	0.968944099378882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03728	glyco_access_1	4.96e-128	480	743	1	265	glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.
PRK09814	PRK09814	1.96e-126	1	332	1	333	sugar transferase.
pfam08759	GT-D	2.42e-100	498	720	1	223	Glycosyltransferase GT-D fold. This domain is found at the C-terminus of proteins such as the probable glycosyltransferase Gly that also contain the glycosyl transferase domain at the N-terminus. It is also found N-terminal in numerous putative glycosyltransferases such as GalT1. GalT1 has been shown to catalyze the third step of Fap1 glycosylation. This domain is structurally distinct from all known GT folds of glycosyltransferases and contains a metal binding site. This new glycosyltransferase fold has been named GT-D.
cd03794	GT4_WbuB-like	3.30e-10	89	285	120	346	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	0.001	33	325	52	371	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ11242.1	6.19e-279	326	744	1	419
BCJ11243.1	5.22e-206	1	313	1	313
AEA00573.1	3.13e-175	1	743	1	883
AUJ29506.1	4.33e-160	1	743	1	617
ANZ71938.1	8.24e-140	1	743	1	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5V4A_A	3.89e-92	480	745	8	274	ANew Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36],5V4A_B A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36]
3QKW_A	2.60e-91	1	331	3	328	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	3.25e-91	1	331	11	336	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]
4W6Q_A	9.71e-87	1	331	3	328	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]
4PHR_A	1.38e-84	470	739	4	273	Domainof unknown function 1792 (DUF1792) with manganese [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2UR93	8.16e-137	1	334	1	335	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
A0A0H2URB1	3.11e-128	340	739	409	809	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1
Q9AEU1	2.60e-125	1	332	1	332	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
Q9AEU2	6.63e-112	342	745	280	682	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2
B5A7L9	1.33e-90	1	331	1	326	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999997	0.000044	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003138_00788.