CAZyme Information: MGYG000003139_01500

Basic Information

• Species: Clostridium_G cochlearium
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_G; Clostridium_G cochlearium
• CAZyme ID: MGYG000003139_01500
• CAZy Family: CBM54
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584		64247.41	5.974

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003139	2361241	MAG	United States	North America

• Gene Location: Start: 33341; End: 35095 Strand: -

Full Sequence      

MKRNFIIALIASMLLTSFTSLGKVQASDIPHERYWGKDRYETSIKISQKGWESGAKYVVL
ASGQGYADALSSAPFAKFIDAPILLTKGDKLEDEVLKEIKRLDPSRVYIIGGEGSISEHV
EDEIKSKITNDVERFKGGDRYETSMKIAQRLPNKEKVILASGEGYADALSAAPIAAINSM
PIVLTPGDRLPKLAEDYLKKDEVKVVYIIGGTASISDTIEKKLPSSIRICGKDRFETNAE
IIRNFPLDFDYKNAYITLGAGETGNEFADALTGSVLAAKDRAPVLLIGKNLNSNTKAIAN
EVLFPNTKFKVLGGVNNVSDKLVEDTKVTITDNFLVKDKEYTSNTLGNAMISEDGIKLKN
SKIKGNLYVKSEDVLLKNTDVKGTIYLDPGRDGEVRLEKVKADKIVVLSGRDEEDGIYLE
DVDANLLKVKSGSKVKVNLRPGTYIKKIHVLANTLIENYQGDYKEIILPKTPNYKELELT
GTFSENIIVEGQVELKTIGGAYVRNILIKTDKEDTIILDGKFDDIEVYTDADIKVTENAS
GRIFGETAKAQTKAEIHVAKGSNIKIEKIRPYNVTGDGKDNALN

Enzyme Prediction     

No EC number prediction in MGYG000003139_01500.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033435	S-layer_Clost	2.85e-31	36	244	389	624	S-layer protein SlpA. In Clostridiodes difficile, the S-layer protein precursor, SlpA, is one member of a large paralogous family of protein that share several cell wall-binding repeats. SlpA is cleaved into a larger and smaller protein. The S-layer protein itself is important to adhesion, and portions of it are highly variable, and then N-terminal and C-terminal are well-conserved.
pfam04122	CW_binding_2	3.24e-25	134	218	1	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
pfam04122	CW_binding_2	4.40e-23	33	118	1	79	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
COG2247	LytB	1.25e-19	58	237	30	250	Putative cell wall-binding domain [Cell wall/membrane/envelope biogenesis].
pfam04122	CW_binding_2	1.52e-17	228	321	1	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV68240.1	0.0	1	584	1	584
QBD84237.1	0.0	1	584	1	584
QBD84238.1	2.53e-149	15	583	4	569
AKA68908.1	4.94e-107	2	511	4	515
AKN31997.1	7.89e-67	12	324	13	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J72_A	1.43e-40	24	333	125	445	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
5J6Q_A	7.74e-36	36	324	291	589	ChainA, Cell wall binding protein cwp8 [Clostridioides difficile 630]
7ACY_B	9.06e-32	36	294	45	335	ChainB, S-layer protein [Clostridioides difficile 630],7ACY_D Chain D, S-layer protein [Clostridioides difficile 630],7QGQ_B Chain B, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_D Chain D, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_J Chain J, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_K Chain K, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_L Chain L, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_M Chain M, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_N Chain N, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_T Chain T, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_U Chain U, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_V Chain V, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_W Chain W, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_X Chain X, Precursor of the S-layer proteins [Clostridioides difficile 630]
7ACX_B	1.24e-31	36	294	45	335	ChainB, S-layer protein [Clostridioides difficile],7ACX_D Chain D, S-layer protein [Clostridioides difficile]
7ACZ_B	1.32e-31	36	339	45	377	ChainB, SLPH (HMW SLP) [Clostridioides difficile R20291],7ACZ_D Chain D, SLPH (HMW SLP) [Clostridioides difficile R20291]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02114	1.04e-41	32	354	29	344	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
Q02113	8.84e-35	32	364	63	376	Amidase enhancer OS=Bacillus subtilis (strain 168) OX=224308 GN=lytB PE=1 SV=1
Q9UYS2	5.39e-12	59	223	21	197	Uncharacterized protein PYRAB14350 OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=PYRAB14350 PE=3 SV=1
O58348	9.78e-11	58	223	30	197	Uncharacterized protein PH0614 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=PH0614 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000454	0.946844	0.051870	0.000336	0.000278	0.000210

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003139_01500.