CAZyme Information: MGYG000003142_02767

Basic Information

• Species: Clostridium_J sp900547625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_J; Clostridium_J sp900547625
• CAZyme ID: MGYG000003142_02767
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		36650.81	6.522

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003142	3709509	MAG	United States	North America

• Gene Location: Start: 5273; End: 6232 Strand: -

Full Sequence      

MEDLYVGNIVRQRRKKTNMFVKMLFLVMMICMLYISINYFIKEDDITLSDSEINLYINAA
DEVSKGKLQVNWKCLAAIDGVRYKKDFSKANTENLKELGENFLEKDGTSSKKNSYKLINL
EDVLNKLSFNEKEKEKVHKYLAELKLIGLASENLRKDSPYMAFIEELSPKAIELYKKHRI
LPSITIGQAILESGWGKSDLSVKANNLFGIKADSSWKGESVSMTTSEYYNDVIQDKFRQY
KNKADSVDDYGKFLVENDRYEKNGLFDATQYIGQAKALENAGYSTKQDENGNNIYSNLLI
NVIKENDLQLIDNMVQSQK

Enzyme Prediction     

No EC number prediction in MGYG000003142_02767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	169	308	3.6e-35	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.48e-49	161	313	44	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	5.68e-29	149	304	142	295	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	1.51e-27	160	310	8	143	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	6.33e-26	171	250	4	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
NF038016	sporang_Gsm	6.25e-24	162	308	162	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC87071.1	6.41e-197	11	319	10	318
AKN30466.1	4.47e-104	15	319	3	309
AQR91467.1	3.35e-102	33	312	28	308
AQS01371.1	3.35e-102	33	312	28	308
AQS15354.1	3.35e-102	33	312	28	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	8.82e-15	163	285	6	133	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.21e-14	163	285	6	133	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	4.46e-14	162	309	3	149	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	5.38e-14	162	309	4	150	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3FI7_A	6.97e-14	163	273	33	140	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	5.94e-24	163	319	51	205	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	4.25e-17	132	285	132	290	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	1.06e-14	162	285	163	291	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P15931	4.82e-13	163	285	155	282	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
Q9I4P4	8.23e-12	163	285	242	370	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000002	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
19	41