CAZyme Information: MGYG000003143_00988

Basic Information

• Species: Clostridium_J sp900548455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_J; Clostridium_J sp900548455
• CAZyme ID: MGYG000003143_00988
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	MGYG000003143_5|CGC1	51486.22	4.4555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003143	3911084	MAG	United States	North America

• Gene Location: Start: 75987; End: 77363 Strand: -

Full Sequence      

MADTGRLQVVVYKNRTYIPIPNARVTVTSTDEDPTFEPKTLVTNEEGKTEAVEIETPPID
RSLERDNTLIPYALVDIRVTADGYSELIVKGIQVLAFKIAIQICNLVSLPGTRDNEREIQ
IERTIDIPPNRQFGDFPPKIPEDPEKPLPPPPSGLVVLPAPVIPEFIIVHAGVPTDTSAP
NYKVPYTEYLKNVASSEIYATWPDSSIRANIYAINSFALNRIYTEWYRGKGFDFDITNST
AYDQAFTYGRNIFDNISLIVDEIFSTFIKRVGAKQPLLAQYCDGRYVSCPDWMTQWGSKD
LGERGYVPFEILTYYYGNDIILDTAPTVSGSPKSYPGYVLTIGSTGEPVRTVQTFLNRIA
NNYPLIGKVPVDGIYGENTAQQVKRFQEIFNLPPTGQVDYATWYKISAIYVGVTKIAELR
SDGEDSNVIESEEYEYFIPPTPCEDINNIPKVGYRKEK

Enzyme Prediction     

No EC number prediction in MGYG000003143_00988.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	3.31e-13	345	406	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	1.92e-08	339	406	38	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	5.94e-07	325	408	106	185	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
pfam08486	SpoIID	0.003	184	246	11	71	Stage II sporulation protein. This domain is found in the stage II sporulation protein SpoIID. SpoIID is necessary for membrane migration as well as for some of the earlier steps in engulfment during bacterial endospore formation. The domain is also found in amidase enhancer proteins. Amidases, like SpoIID, are cell wall hydrolases.
TIGR02669	SpoIID_LytB	0.008	293	316	237	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWZ49621.1	8.61e-180	1	454	1	443
VTQ95559.1	2.86e-175	4	454	3	441
AYE34395.1	2.03e-172	1	456	1	444
QAS59800.1	2.03e-172	1	456	1	444
QAA30635.1	2.51e-170	1	454	1	447

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003143_00988.