CAZyme Information: MGYG000003144_01336

Basic Information

• Species: Aeromonas rivipollensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas rivipollensis
• CAZyme ID: MGYG000003144_01336
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	MGYG000003144_4|CGC1	82365.55	10.1001

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003144	4456944	MAG	United States	North America

• Gene Location: Start: 135956; End: 138202 Strand: -

Full Sequence      

MGVISLILLLLVLDRIFPPPPLDPAYARVVLDIKGRPLRAFADTSGVWRYPVTLEQVSPR
YIEALLGYEDRHFWRHPGVNPVAMVRGVWQWLRYGRAVSGGSTLTMQVARLIEPYHRSVP
GKLRQMARALQLEWHYDKRTLLTVYLNRAPFGGNLEGVQAASFAYLGKSAAKLTHAEAAL
LAVLPQAPSRYRPDRHPERARAARDKVMQRLVVQGVWPEVVWQEGRIEPVLARGHFTPME
APLFARLAADHQAGALVHTTIDGDLQRWLEARVASYIRRFPEQTSAALLLVDNSTMAVRA
YVGSAEYGNLRRHGYLDMVQAIRSPGSTLKPFIYGLALDEGLVHSASLLSDAPRLGSDYR
PANFTGAFQGPVTLTQALQQSLNVPAVQVLEALGADKLVSRLDNAGVRLALSDKPNPAIA
LGAAGIRLEQLVALYSALTRQGQVAMPVWLAGQQAVSRPLLSPGAAWIIWQILSAQGRAD
QPFASEATGRVNRLAWKTGTSYGYRDSWAMGVSGRWTIGVWLGRPDGTPLPGFYGQSAAV
PLLLSVYSRLSDNSPLPAQPNTVSEAEICWPLGRKASTTLPEACLQRQSAWLLDERDPPT
LPDPMDWPSPLRQVALTSEGKPTLARCPDAAQSVLRALWPLSLEPWRGSGERRQALLASH
CAGEGRSADLQAPIRILALGEGNLIRSQRYRLQPRVLGGVGKPHWFLNGQRLRWDGDQVL
SKAGRYQLVVVDEAGNSDRIEFRLENPS

Enzyme Prediction     

No EC number prediction in MGYG000003144_01336.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	46	211	4.1e-50	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11240	PRK11240	0.0	14	745	27	772	penicillin-binding protein 1C; Provisional
COG4953	PbpC	0.0	14	746	22	733	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02073	PBP_1c	0.0	19	745	1	727	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.22e-107	29	612	57	658	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	3.06e-103	49	542	2	520	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJT31197.1	0.0	1	748	46	793
AHE49006.1	0.0	1	748	1	748
QJT21414.1	0.0	1	748	46	793
AVP94738.1	0.0	1	748	46	793
QIY88944.1	0.0	1	748	46	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	9.14e-39	49	583	39	757	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2OQO_A	9.43e-33	32	219	6	192	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5FGZ_A	1.68e-32	22	557	140	697	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	1.80e-32	22	557	161	718	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3NB6_A	3.26e-32	32	219	6	192	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	6.68e-227	14	745	29	770	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
P38050	1.13e-47	49	567	67	614	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q9KUC0	2.46e-45	55	529	186	694	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
O66874	2.94e-45	4	563	17	683	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P70997	1.83e-40	46	539	71	596	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.329421	0.669003	0.000728	0.000289	0.000237	0.000315

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003144_01336.