CAZyme Information: MGYG000003144_01464

Basic Information

• Species: Aeromonas rivipollensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas rivipollensis
• CAZyme ID: MGYG000003144_01464
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512		57502.43	10.2739

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003144	4456944	MAG	United States	North America

• Gene Location: Start: 278254; End: 279792 Strand: +

Full Sequence      

MKLRTALLAALFLSGCQNLSHQDDRAVTAIEPIKSPQVSKKTYKKHSARFLFGDEQIEEL
DDTDNLWVRISDDMQLDSHDNARVRQQRDWLLRNDKHMATIASRAEPYLYLMVEEIERRE
LPMELITIPMIESMFDPNARSRSNAVGLWQFVPATGKNFGLRHDNWYDGRRDVLASTNAA
LDYLEYLNRFFDGDWLQTLAAYNAGEGRVRNAIIRNQKAGRPTDYWSLDLPRETRMYVPK
ILAMADMIRNADKYNVTLPVLANKPQLRTINTGGQIDLNVAAQLAGVSASQLKALNPALK
RGMTSPRGPYNLLVPIEYADTLELALADLPQRERTRGVRSYQVTSGDTLSRIAQNHGVSV
QQLKLANNLRGNNLRRGQSLVIPNGGTASQAVQSKQQLASRSGSKIQYQVRSGDNLWSIS
QAHGVTHADLAKWNGLSAKSALKPGMKLVVWPKQGKGSNKSMVYQVRRGDSLSSIAARFQ
VAVNDVMRWNQLGKTDYLKPGQELTLFVKNNS

Enzyme Prediction     

No EC number prediction in MGYG000003144_01464.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	108	255	8.5e-26	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	2.56e-161	1	512	1	452	membrane-bound lytic murein transglycosylase D; Provisional
cd16894	MltD-like	1.04e-62	116	246	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	6.45e-30	122	220	12	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK06347	PRK06347	2.30e-27	335	504	327	521	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	5.36e-25	330	506	397	591	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVP94878.1	0.0	1	512	1	513
QIY86938.1	0.0	1	512	1	513
QYK81905.1	0.0	1	512	1	513
QJT21299.1	0.0	1	512	1	513
AHE48871.1	0.0	8	512	1	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1E0G_A	1.38e-10	461	509	2	48	LYSMDomain from E.coli MLTD [Escherichia coli]
7EYB_I	9.80e-10	132	245	37	146	ChainI, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_B Chain B, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_D Chain D, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_F Chain F, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_G Chain G, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]
6YT5_G	9.83e-10	132	245	59	168	ChainG, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_H Chain H, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_I Chain I, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]
6FBT_A	4.37e-07	112	261	453	603	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	4.48e-07	112	261	482	632	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ8	3.13e-106	1	453	1	445	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P0AEZ7	3.13e-106	1	453	1	445	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P32820	2.30e-35	102	222	19	139	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
P37710	3.81e-15	341	512	499	678	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
O31852	5.43e-14	340	506	89	268	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000057	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003144_01464.