CAZyme Information: MGYG000003144_03303

Basic Information

• Species: Aeromonas rivipollensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas rivipollensis
• CAZyme ID: MGYG000003144_03303
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
167	MGYG000003144_14|CGC1	17780.46	7.52

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003144	4456944	MAG	United States	North America

• Gene Location: Start: 79906; End: 80409 Strand: +

Full Sequence      

MPLHIRLLALMALLLGGCALQPRPESLLMGAAPRSTPVPPATLVTGGGFCVALSEQGSLL
TQTCDQSPRQLFTWDAGALQLAQGCLIARGDNGLAVGECQDDSRQWQWQGDRLFNRQVSL
CLDVAGRRHRAAVPLRLAECYGGANQSFTWTPTGSLLDRLGLPGLSG

Enzyme Prediction     

No EC number prediction in MGYG000003144_03303.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00458	RICIN	5.51e-10	46	151	5	118	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
cd00161	RICIN	2.64e-05	42	150	4	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
NF035930	lectin_2	0.001	64	146	147	236	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
NF035930	lectin_2	0.001	120	156	128	163	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
NF035929	lectin_1	0.008	31	149	704	835	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHE47548.1	1.86e-114	1	167	1	167
QYK83366.1	7.30e-112	11	167	1	157
QJT23999.1	7.30e-112	11	167	1	157
QIY89079.1	4.23e-111	11	167	1	157
AVP95441.1	1.42e-109	11	167	1	157

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000049	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003144_03303.