CAZyme Information: MGYG000003144_03311

Basic Information

• Species: Aeromonas rivipollensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas rivipollensis
• CAZyme ID: MGYG000003144_03311
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000003144_14|CGC2	38667.67	8.5829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003144	4456944	MAG	United States	North America

• Gene Location: Start: 87654; End: 88709 Strand: -

Full Sequence      

MPLFQTPPSSICILRLSAIGDCCHALALVRVIQRAWPETRITWITGKIEATLFADLPGVE
VIPFDKSKGWRGYRDLWQTLKGRRFDALLHLQAALRASIATLGIRAKIRLGFDKERANDG
QWLFTNHQVPSPASPHVLDGFLAFARELGIQDLTPDWQLPISAGHQAWAREKIDGKPTLL
ICAAASKAFKNWTAEGYAALADHAASKGFQVYLCGGPAKLERDLAADIQRLSQSKPVDLV
GQTNLKQLLALIKEASLVLAPDTGPTHMATLVGTPVIGLYAHHNPDRTGPYLCREYAVSV
YQELIEQETGKPLAALDWRTRLKDPDAMGKITSERVIAAFDRLCAERQLPG

Enzyme Prediction     

No EC number prediction in MGYG000003144_03311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	75	302	1.8e-52	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	4.74e-77	10	342	3	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.03e-74	10	342	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	6.10e-55	74	313	2	243	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	1.34e-22	7	280	4	288	lipopolysaccharide core biosynthesis protein; Provisional
PRK10916	PRK10916	3.86e-09	190	346	195	345	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYK80836.1	2.05e-255	1	351	1	351
QJT20078.1	2.05e-255	1	351	1	351
QIY88164.1	3.40e-254	1	351	1	351
QSE75129.1	1.96e-253	1	351	1	351
AHE47556.1	3.96e-253	1	351	1	351

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	1.03e-114	1	343	1	344	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
Q9R9D5	1.32e-13	20	280	5	276	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	1.83e-13	20	280	5	276	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003144_03311.