CAZyme Information: MGYG000003145_00818

Basic Information

• Species: UMGS822 sp900545825
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; UMGS822; UMGS822 sp900545825
• CAZyme ID: MGYG000003145_00818
• CAZy Family: GH33
• CAZyme Description: Sialidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615	MGYG000003145_6|CGC1	66518.08	4.8538

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003145	2320952	MAG	United States	North America

• Gene Location: Start: 6467; End: 8314 Strand: -

Full Sequence      

MAAIVSSSPSSGRTADGSTACWIFFGKLRPIDRTTIRAKPTDRMARAPPSDTFEATAAPR
TGPTAPPSATTLTYAVLTPEGEWRTWQADGEWADGKWHDVVVRAGEGAIDLYVDGFREAR
IPGQAFFGDIDGVDQIMIGQDIHGSRLFGEVSRAMVYPTPLTDGQIKRLSHVEPLHTRAL
FDRGMEGSISYRIPSLLTLPSGVIIAGADQRTTIANDSPNDINFTVRRSLDGGKTWEGLQ
EVLVYPGEGADGASVIDSCTVYDAETGVVHCLIDHFPGGIGQPNNAHGTGMDDKGHFVLT
DTAGHEYIVQSDGTVTTADGEATDYVVAPSGDVTKGGKPAGNIYLKDGVDPNQSLLTART
SYLVHIYSEDEGATWSEPIHLNSQVKEPWMAFLGTSPGTGLQLTRGAHKGRLVIPVYYSG
DHTKQFSAAVVYSDDHGKTWKRGKSPCDGRVFKGETLDSKTLADDEASTHESTIMELPDG
RLLVLMRNQHPSGRVGKAISTDGGETWGEVTYQSDIPEIFSQPNGIALSLADGRRALAFA
NASQLMPYRGNGVLRVSLDDGETWPIHRTFNPGHYVYQSMTQLPSGAIGLLWENEWQGLY
FTEIPLSWFGSDELA

Enzyme Prediction     

No EC number prediction in MGYG000003145_00818.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	179	595	5.8e-94	0.9327485380116959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.49e-91	180	605	3	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	5.97e-23	326	590	37	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	8.42e-20	177	593	261	700	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam13385	Laminin_G_3	5.99e-07	67	167	51	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
pfam13859	BNR_3	1.97e-04	358	509	85	213	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR18588.1	5.22e-300	68	612	206	784
QRP10095.1	5.22e-300	68	612	206	784
QRP14191.1	8.54e-299	68	612	206	784
QRQ65718.1	8.01e-297	68	612	203	774
QGS10500.1	6.97e-236	72	614	203	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TSP_A	4.01e-87	180	594	13	431	Crystalstructure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124],5TSP_B Crystal structure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124]
2BF6_A	7.88e-87	180	594	12	430	AtomicResolution Structure of the bacterial sialidase NanI from Clostridium perfringens in complex with alpha-Sialic Acid (Neu5Ac). [Clostridium perfringens]
2VK5_A	8.59e-87	180	594	12	430	TheStructure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK6_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_B The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens]
2W20_A	3.17e-65	186	615	21	470	Structureof the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6],2W20_B Structure of the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6]
3H72_A	3.67e-65	186	615	25	474	Crystalstructure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H72_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H73_A Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6],3H73_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29767	2.71e-73	126	614	313	831	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P62575	5.46e-63	95	615	218	790	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1
P62576	5.46e-63	95	615	218	790	Sialidase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=nanA PE=1 SV=1
Q02834	1.62e-37	173	611	48	403	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
Q27701	4.99e-34	111	594	206	730	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999894	0.000165	0.000004	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003145_00818.