CAZyme Information: MGYG000003145_01952

Basic Information

• Species: UMGS822 sp900545825
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; UMGS822; UMGS822 sp900545825
• CAZyme ID: MGYG000003145_01952
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763	MGYG000003145_27|CGC1	83272.37	4.4254

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003145	2320952	MAG	United States	North America

• Gene Location: Start: 2542; End: 4833 Strand: +

Full Sequence      

MTQDVPTFLSELDCFPLSDPQPAWVSPDPRWDQGAEGPAWRLFTQVTLEDEVAQATAFFT
AKGVADLWINGQLAHAETMLPGFASYRHRMPFVALDVTGLLRAGANRIGAEVADGWWRGR
IGFDGGWVNLWGSEVAVALRIDVTYRDGRTQTIVTDQSWHACPSPRLRAGLYGGETYDAR
LDSPAWMTPGAQVTGQREVATAQVTEHFVPLGQRRLVPCERLRPATTTRLEDGTILVDFG
QNASGRVRVTADIPAGRALRLRHAEVCQEGRIYTRPLRLAHAEDVFLGDGQGLRTFEARF
TTHGFRYVELSDATEGVDLDSLEFVVVRSPIALESSLETSSDLLNQLVSNVQWSLRSNFA
SIPTDCPQRDERMGWTGDIQAFGPTALTLGDCAPFLVDWLRDVRAEQVEHGSVPVYVPFV
PAPHFWNATPHLAVWDDVATLLPWALWERTGDRDALAEEWPLTSTWADQLIALLGEDDLW
RGDLQLADWLDPTAPPDNPLQAQTDPDLVANAFAYRSLDVAAQIGRLLDRPDEAQRYEDA
AARVRAAWRARYLEGDSALTSPTQTAYALAIVYGLLDDDELPAAGERLSALVAERDGCIA
TGFAGTPVICDALTQTGHVADAYRMLGQTRCPSWGYPITQGATTVWERWDSLLPDGTVNP
GGMTSFNHYALGAVVDWMFRVIGGISPATPGYAQVTIAPQPGGDLTSSRCRLATVHGTIA
SDWTLEDGTLTVTGALPEGVTGTVILPGGSRTTIAAGPFRVTE

Enzyme Prediction     

EC	3.2.1.40	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	228	746	1.5e-157	0.996031746031746
CBM67	38	190	3.3e-22	0.8068181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.79e-117	335	682	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.15e-44	51	207	2	158	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.43e-27	228	327	1	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.23e-17	684	754	1	71	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX81960.1	7.30e-253	60	762	2	695
ANF32626.1	5.21e-221	42	763	133	855
AKZ54134.1	2.14e-219	18	748	109	841
CAJ89979.1	2.14e-219	18	748	109	841
ANB04895.1	3.03e-219	18	748	109	841

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	7.30e-158	45	757	137	859	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	1.03e-149	51	747	315	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	3.73e-90	47	747	184	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	4.14e-149	51	747	315	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	3.22e-131	48	747	183	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	7.72e-119	42	747	173	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.87e-57	45	746	190	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003145_01952.