CAZyme Information: MGYG000003146_00896

Basic Information

• Species: Streptococcus oralis_S
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus oralis_S
• CAZyme ID: MGYG000003146_00896
• CAZy Family: GH8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000003146_6|CGC1	42699.25	6.1519

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003146	1940370	MAG	United States	North America

• Gene Location: Start: 44192; End: 45295 Strand: -

Full Sequence      

MKTNKLKYVWFVLILSIFCLTLFLARGRTKIEMRNRIYSQWSQQFLVTKGDQSYVRTTND
SEETIVLSEAQSYGMLITVLAAQKGQASQADFDNLYRYYQNHRIEGTQLMSWKQVIKNGS
ETVKKQNATDGDLYIAYSLIEASKQWPDKAQEYQEQAKKILEDILRYNYNKETGVLTVGN
WANKNSDYYYLMRTSDTLPHYFQSFYDLTGNKQWLDVKDKMLGQLEQISSHSDTGLLPDF
IWAEKSGARLVDANTIESQYDGAYSYNACRLPYHLSQSQDERSQKLVQKMMDFFMKEQRI
YAGYDLNGTALNQYQAGSFLAPITYASDKGEGYLKLLQQNKYIFTQDLPLDNYYDATMIT
MIALEMF

Enzyme Prediction     

No EC number prediction in MGYG000003146_00896.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	38	363	1.2e-71	0.978125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	3.86e-25	38	364	8	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	4.46e-23	37	296	25	277	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	8.27e-09	68	166	54	150	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF56361.1	1.42e-270	1	367	1	367
QLL99084.1	1.42e-270	1	367	1	367
ANR74454.1	1.12e-267	1	367	1	367
QQL00752.1	8.46e-263	1	367	1	367
QRO06681.1	8.46e-263	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	2.33e-39	29	322	54	359	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	4.25e-27	38	327	35	340	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	4.85e-27	38	327	41	346	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	4.00e-11	68	276	33	231	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
3QXQ_A	8.90e-09	65	266	30	227	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	1.78e-38	38	322	66	359	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	2.28e-24	38	326	91	395	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P27032	1.39e-08	41	275	30	248	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
Q8X5L9	1.61e-08	65	266	51	248	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	2.15e-08	65	266	51	248	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.761226	0.158173	0.075852	0.000647	0.000441	0.003682

TMHMM  Annotations     

start	end
7	25