CAZyme Information: MGYG000003147_00345

Basic Information

• Species: Robinsoniella sp900555455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900555455
• CAZyme ID: MGYG000003147_00345
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1283	MGYG000003147_1|CGC10	142333.44	5.4105

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003147	4940098	MAG	United States	North America

• Gene Location: Start: 434998; End: 438849 Strand: -

Full Sequence      

MKNKTFAMIGALLMFAGTLGVNGLHVKASPNGAEQITGNGVSVIFSREEGTVQLFRTDAD
GNQTVMTQRSQVSIPVVNGQEVTDFSDFQCEVQENVTGAAGAGSRMTIISVSKDTGLQRS
VVIQTVDEVKGLLHISTSYKALAEEVNAEGFIDSRFSLDHPSNTVWSYNGGGEGSQSWYD
TLQKIDLMDGESFYRENLQDDTAAGIPAADIYGEQGGVTVGDASVTRRQLSTPVNERNGS
VEVSVKHPGAVLTAHTKTEISQSFVNVHSGDYYSGLRGYADGMKQIGFTTLSREQIPESS
YVLRWESWGWEFDWTVDLIINKLDELKEMGVKQITLDDGWYNAAGEWGLNSWKLPNGAAD
MRRLTDAIHERGMTAVLWWRPCDGGREDSALYQEHPEYFIKNQDGSFGRLAGPGQFNSFL
GSCGYALCPLSEGAVQSQVDFINRAMNNWGFDGFKSDYVWSLPKCYSQEHRHARPEESTE
QQAQFYLAVYEAMTANNPDAFHLLCNCGTPQDFYSLPYVTQVPTADPTSVDQTRRRVKAY
KALCGDYFPVTTDHNEVWYPSTVGTGAILIEKRDLSGWEEEEYAKWLKIAQENELYKGTF
IGDLYSYGYDPYETYTVDKDGVMYYAFYKDGNRYRPDGNPDIELKGLEDGKLYRIVDYVN
NVVVATNVTTSNAVFSYPFSNYLLVKAVEISEPDTEGPGPVPDPAGTVTVEESAPELEYS
GSWVTEENEGYHGGGACYTKEAEASVELEFYGTGAAWYGQHDVNFGTARIYIDGTYVETV
SCMGTPGINIKLYEINDLKLGSHRIKIECETPVIDIDRLTYTKGKEIPSKLRTGDLRALA
DLANQYDMNSFEDGSYKDQMGVSLVRANQLLEADNVSQSAVNEEQKYLLNAMLKLRKKVH
KDWIGLSGPVPGEVPTEDISRENLAKVISYTEQLEKDRIIPVVKGQLSTSYEQAVSISER
QDASQTEIDRAWSSLMNAVQYSGYTQGSKEKLSALLDECKKLNTDIYKDTVAFLASLEAA
EKVYQDENAMDGEISDYIGQLQKAKDQLELKDPVNPPDPDPDPDPKPKPDPAPNPNPDPA
PNPKPDPSPNPKPDPSPGPNPDPVLKKPEQVAGVKVKAGTASLTVSWKKLHNAKSYKVYI
HKSGKWRLAGKTTKTSYQIKKLASGTRYTIKVAAVNKFGQGKYSQQVYTAAKPEKVKLKS
VSRYRTTKVKLNYGKVKAGGYEIWMKVGSHAYKKAGTSSKTIAVKGGLKKGKTYYFKVRA
YVKNKNKVIYGSFSNVKKYKRII

Enzyme Prediction     

No EC number prediction in MGYG000003147_00345.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	275	529	3.3e-31	0.35755813953488375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.36e-33	305	554	6	244	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.67e-16	310	528	48	262	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	2.96e-14	288	401	274	396	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd00063	FN3	3.95e-10	1108	1187	1	89	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	3.85e-08	1108	1181	1	83	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA30399.1	0.0	36	821	46	824
QQR05374.1	0.0	36	821	46	824
ANU41754.1	0.0	36	821	46	824
ABF39669.1	1.12e-83	28	687	32	681
ARU29327.1	6.16e-83	77	690	76	689

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PHU_A	6.20e-10	283	401	330	447	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6PHW_A	6.20e-10	283	401	330	447	ChainA, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DTR5	0.0	36	821	46	824	A type blood alpha-D-galactosamine galactosaminidase OS=Flavonifractor plautii OX=292800 PE=1 SV=1
P0DTR4	3.70e-19	699	821	647	769	A type blood N-acetyl-alpha-D-galactosamine deacetylase OS=Flavonifractor plautii OX=292800 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001259	0.995546	0.002508	0.000240	0.000206	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003147_00345.