CAZyme Information: MGYG000003147_00570

Basic Information

• Species: Robinsoniella sp900555455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900555455
• CAZyme ID: MGYG000003147_00570
• CAZy Family: GH4
• CAZyme Description: Alpha-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000003147_2|CGC3	37736.89	5.6061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003147	4940098	MAG	United States	North America

• Gene Location: Start: 214233; End: 215210 Strand: +

Full Sequence      

MSVKISLIGAGSGIFSINLIKDLCLAKNLSDSRICLMDINEDRLDDIYRMCVRYAEEAGT
ALEITKTTDRLECLQGADFVVNTALDGGYERLKEGWKVAKKWGYRFGGSFHIVHDESFWV
NFYQLRLMEEIYHDMQKVCPDAWYIMVSNPVMGGVTYLTRKYKGIKLAGMCHGYGGVYRL
CELLGLERENVTFQVPGINHFVWLNSFYYKGENAYPLLDQWIAEKSEDYFKTCRYSDDFG
PKAIDLYQKYGVMPIGDTCTPGGGSWGYWYHTDGEVQEVWREDPDHFYEEYFQTSQKHVE
DIHRAAHDDSIKMMDFFSKVRRMSR

Enzyme Prediction     

No EC number prediction in MGYG000003147_00570.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	4	181	1.2e-47	0.9720670391061452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	4.30e-86	3	312	1	307	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	6.61e-66	1	290	2	278	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
cd05197	GH4_glycoside_hydrolases	3.12e-59	3	258	1	254	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
PRK15076	PRK15076	1.07e-53	2	225	1	224	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	2.62e-37	4	186	1	183	Family 4 glycosyl hydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH41562.1	4.49e-145	1	310	1	310
ACZ42865.1	1.48e-140	1	317	1	317
QBD76473.1	1.71e-134	1	317	2	317
BBI35842.1	5.97e-130	4	320	3	320
BBH19141.1	1.20e-129	3	320	2	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1OBB_A	2.35e-76	2	284	3	283	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
7BR4_A	3.74e-59	3	280	13	298	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]
6KCX_A	3.82e-59	3	280	13	298	Crystalstructure of citrate complex of alpha-glucuronidase (TM0752)from Thermotoga maritima [Thermotoga maritima MSB8],7CTD_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8],7CTL_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8]
3U95_A	3.59e-58	3	280	1	286	Crystalstructure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_B Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_C Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_D Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_E Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_F Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359]
7BRF_A	1.13e-57	3	280	13	298	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8],7CTM_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33830	4.16e-77	2	284	3	283	Alpha-glucosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=aglA PE=1 SV=2
O86960	8.27e-77	2	284	3	283	Alpha-glucosidase OS=Thermotoga neapolitana OX=2337 GN=aglA PE=1 SV=2
O34645	5.37e-24	4	227	3	226	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
Q9AI65	4.99e-20	1	237	1	237	Alpha-glucosidase OS=Erwinia rhapontici OX=55212 GN=palH PE=1 SV=2
D3T426	2.92e-17	3	253	11	267	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003147_00570.