CAZyme Information: MGYG000003147_01012

Basic Information

• Species: Robinsoniella sp900555455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900555455
• CAZyme ID: MGYG000003147_01012
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484	MGYG000003147_4|CGC3	56343.68	4.8958

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003147	4940098	MAG	United States	North America

• Gene Location: Start: 191689; End: 193143 Strand: +

Full Sequence      

MNAMQRDLAKLVREKEESGFKEWDDDQWRPGFHLMPVTGWLNDPNGLCYYKGFYHVFFQY
SPFDENGGVKFWGHYKSKNLTEWEYLGTALYADQPYDCHGVYSGSAYIEEDTMYLYYTGN
VKLLGDFDYVNKGRESNTVLAISKDGISFENKNCIMTNADYPSNCTCHVRDPKVWREGDR
YYMVQGARRRGTVQGEDIGEVLLFESEDKVNWQIWDRITSENPFGYMWECPDYFQLDGVN
ILAVCPQGVNPEGIRYRNIYQCGYFTADKKIMSQCRLSDFTELDYGFDFYAPQTFQDEKG
RRIMIGWAGMPDADYTNPTAQKESWQHCMSVPRVLEWKNGQIFQRPVEELQMLRQEKISE
EIAGCFVQKGLSMYEIELFVSQAFEIRIAQDLVIKYKPNSREIVLSLSGSLASGRNSRNV
FVDKMDKIHLLVDNSILEVFINDGEKVMTTRFYPKEKVHDLMINADSGKVHLWKLDAMGF
RMGE

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	33	346	2.9e-92	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	2.34e-157	39	339	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	2.97e-153	26	455	11	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	9.91e-144	25	472	25	477	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	1.76e-114	33	444	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	4.57e-112	33	346	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH67471.1	2.77e-176	1	480	1	479
ADZ81804.1	1.12e-175	1	480	1	479
CBL24955.1	6.42e-173	1	456	1	456
AUJ50905.1	2.08e-171	1	456	1	471
QTM12256.1	2.94e-171	1	456	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.61e-81	27	476	24	481	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	1.08e-67	1	453	21	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	1.60e-66	1	453	21	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	5.24e-63	12	478	4	488	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
1UYP_A	2.09e-53	28	476	2	428	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	4.57e-102	1	475	1	478	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	1.33e-95	5	472	18	482	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	2.07e-84	26	453	34	453	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P27217	5.42e-83	26	454	24	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P40714	2.23e-81	1	468	6	464	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000090	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003147_01012.