CAZyme Information: MGYG000003147_01196

Basic Information

• Species: Robinsoniella sp900555455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900555455
• CAZyme ID: MGYG000003147_01196
• CAZy Family: GH63
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
719	MGYG000003147_5|CGC1	82358.33	5.0144

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003147	4940098	MAG	United States	North America

• Gene Location: Start: 149773; End: 151932 Strand: +

Full Sequence      

MWNTYCAGELNSVLHLPDMASVRIGIYDCTQKFLLDRMLWRNQADEGNMYKNVKRFGLHA
EDGSYFDIDLNYQDFSFRLEFVSTGDCFAYRVTPLQKKEKIYFFLCASILWMHKGSVEVL
QDGLSIRSENKDYMIKTNAAFISHVKVNTSLPGILVESNQVFYITCNMNTDPDLIALHLD
AARRQCISSSAHSGGWLDGVSDALQKGMGWNTIYDHVKERICSPVSRAWCVQNGKGFGSY
VLFEWDTFFSALMGATYSRKFPRWQIDAIFQEMTSDGMIPNFGSERGGSPDRSQPPVGSY
CILKLYQQFQDKNLLERYYEPLVRWNKWWFENRDGNHDGLLEWGSNPNPSGTEQGYFDNG
NTMACAMFESGLDNSPMYDQVVFNEKTNTMELADVGLNSLYALDCKCLAFISRVCGRLTE
EKLYQAEFERMKEIMNQKMYDPNAGMYCNLHWNGEKDYRFSPTNFYPLLAGIPSAGQAKA
MVNGHLLNENEFWGTYVIPSISKSCSAFSDQDYWRGRIWGPMNFLVYEGLKQYSCLEEFN
RIAYLFADKSLKLFMNEWNEESHIHENYNCITGDGDDKFNADPFYTWGALLAYLPMCELI
YVHPYGGIRFGNFYAPASTIEGFLVGSSSYDLCTKNGFMLNRNNKQLIASNEMIIMDHFT
LTEGIISAVVITSKTCCITLYPQPEIIHYTLRLSNGMIIFDGALDKQITFSQLNSENSF

Enzyme Prediction     

No EC number prediction in MGYG000003147_01196.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	243	593	1.7e-33	0.3508771929824561

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	5.83e-22	245	596	350	778	alpha-glucosidase; Provisional
pfam01204	Trehalase	1.15e-19	242	575	128	480	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	5.40e-14	243	591	93	488	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	1.27e-10	242	546	172	499	Neutral trehalase [Carbohydrate transport and metabolism].
PRK13270	treF	3.77e-04	389	574	343	516	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ95189.1	2.02e-197	2	654	7	644
QGQ95190.1	1.39e-175	2	666	11	667
QLE02613.1	5.60e-120	2	602	42	623
QNI32096.1	1.46e-119	2	600	9	602
QNK58860.1	1.99e-112	2	598	29	614

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.69e-16	233	594	311	751	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	6.74e-16	233	594	311	751	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	8.88e-16	233	594	311	751	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.85e-14	233	593	312	751	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
6XUX_A	1.26e-07	408	594	113	300	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	9.49e-16	233	594	334	774	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
P32356	1.93e-06	242	582	306	690	Cytosolic neutral trehalase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTH1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003147_01196.