CAZyme Information: MGYG000003147_01743

Basic Information

• Species: Robinsoniella sp900555455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900555455
• CAZyme ID: MGYG000003147_01743
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
809	MGYG000003147_9|CGC1	94358.78	4.7262

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003147	4940098	MAG	United States	North America

• Gene Location: Start: 54309; End: 56738 Strand: +

Full Sequence      

MITFELNTNWTMQIQGQEEKLQAVIPGSVYHDLMMNGKMDDPFWRDNEDEALKIMEQDFI
YETSFDVPEDIFSSDEVLLHCEGLDTIASLYVNGICIGNAENMHRCYEFPVKEQLNKEDN
KLMIIFASPVKYIRERYAECITMGSEHCMDGFPQIRKAHCMFGWDWGPRLPDAGIWRGIS
LYGISGARIDGVYITQEHAKDSVTLKLEVDARNKDAGSKTDYTVEMIDPDGERKVFSQSP
EKIVVNHPKLWWPNGFGSQPLYEIAVSLYTDGIETDVWRKRIGLRTMTMHREKDCYGESF
AHEVNGVQIFAMGADYIPEDSIYSKITRDRTRILLEQCKEANFNCVRVWGGGYYPDDYFY
DICDELGLVVWQDFMFACAVYELTDAFEQNIRSELIDNIKRIRHHACLGLWCGNNEMEMF
VDQGTWVNTLKQKADYIKMYEYIFPQILKQYDPNAFYWPASPSSGGSFDMPNDPDRGDVH
YWDVWHGDKPFSEYRKYYFRYASEFGFQSFPCLKTVENYTLPKDRNIFSYIMEKHQRNDA
ANGKIMNYLYQTFLYPEDFGTLLYASQLLQAEAIKYGVEHFRRNRGRCMGAVYWQLNDCW
PAASWSSIDYYGRWKALHYYAKKFFAPILLSCMEEGVLTQNTNVNAQPFKLEKSVCFNVS
NETMEDHIVTVKWAVRDRFAGIIREEEEEIKVASLSAGWLLKKDLPLIDIYKEYISYDLY
EDGRWLSGSTVILSLPKHFQYENPHLTVSMEGEEVVIHADAYAKSVEVLNEEEDLILSDN
YFDMNAGERRLRVLRGEPVHLRVRSVYDI

Enzyme Prediction     

No EC number prediction in MGYG000003147_01743.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	756	4.1e-104	0.7632978723404256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	6.93e-89	6	631	15	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	2.71e-13	187	285	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	4.58e-11	9	385	79	409	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17753	Ig_mannosidase	4.59e-10	743	808	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10150	PRK10150	2.27e-06	173	286	168	277	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF82182.1	0.0	1	809	1	815
QIB54534.1	0.0	1	809	1	822
QMW79049.1	0.0	1	809	1	822
QBE97789.1	0.0	1	809	15	836
QJU13790.1	0.0	1	809	1	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	1.65e-145	1	805	3	834	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.69e-145	1	805	3	834	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
7OP6_A	4.66e-145	6	809	13	842	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2VJX_A	6.05e-145	6	808	11	836	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	6.38e-145	6	808	13	838	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	1.15e-113	4	796	7	830	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q0CCA0	1.81e-109	23	796	30	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q5B7W2	2.62e-108	6	661	9	687	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
B8NW36	2.05e-106	4	653	7	679	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q2TXB7	2.05e-106	4	653	7	679	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003147_01743.