CAZyme Information: MGYG000003147_01946

Basic Information

• Species: Robinsoniella sp900555455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900555455
• CAZyme ID: MGYG000003147_01946
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865	MGYG000003147_11|CGC1	99231.92	5.1247

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003147	4940098	MAG	United States	North America

• Gene Location: Start: 3631; End: 6228 Strand: +

Full Sequence      

MIYEKEYTNQISFPLGGIGTGSIGLSGTGRLIDWEIFGRPNKQSYNGYSHFAIKVEKDGR
VLDTRILNADLAPHYIGGVKTENIHSGFGFGPDQITMAGFPHFKEVRFEGEFPVACLTYR
DEHFPSEVKLTAFNPMIPSDAWNSSVPAAFFEFEIGNPTEDDLDYMLAFSVSNPTGTKKV
CHRYEEKDGIRYLKLDCGEFDKEDYHFGNLCISTDCEDTSFQEYWYRGGWSDGVEMYWND
LTGSGKLKNRRYEADYMVNQQVVHDVGTLAAHVHIPAGKAKKIRFVLSWYYPNIVKSWEV
KYHPEKRMEDMPVWRNYYASMFPSSRACADYAMKNFDSLQNRTLVFKNTLFRSSLPKEEL
DAVASNLSTLKSAAVLRLTDGSFYGFEGCIEDAGCCEGSCQHVWNYAYALPFLFPGLERS
MRDLELKYSMAADGRMGFRLQLPLGTPPADFRACVDGQMGFVIKVYREWKISGDDKWLKE
NWTGVKKALEYAWSDSNEDLWDEGCSGVLRGRQHHTLDMELFGANSWLQGFYLCALKAAS
AMAKYLGDSKKAELYREIFVKGKEWTDRHLFNGGYYCQDIVLSDQSVLEPFKDQACLFGD
GTMDIYWNEENGEIKYQIGEGCMIDQVIGQWHANNCGLGEIFMEEQTKKSLESIYRHNYH
KSMREIANPWRLYNLNDEGGTMICTWPQGKKRPAIPLTYNSETMHGYEYQFACHLAQMGM
WEESHEVVKAVRDKYDGCKRNPYNEIECGSNYARSMASYGLLLAYGGFCYDMTKGMIGFY
PRTDVDQFETFWSLDGAWGRFYCKGSEMEFQVLEGSIRIKEFHWGWLQGKLADRCSAGDW
RQEGEILYLDVTLYEGEQISLSCKD

Enzyme Prediction     

No EC number prediction in MGYG000003147_01946.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	384	760	3.1e-60	0.9862258953168044

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12215	Glyco_hydr_116N	2.37e-58	13	339	2	309	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
COG4354	COG4354	5.14e-48	1	768	1	720	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam04685	DUF608	8.15e-39	403	761	19	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG3387	SGA1	0.003	479	589	384	486	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
COG3459	COG3459	0.003	501	657	741	857	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH18759.1	0.0	2	820	4	815
ANE45793.1	0.0	2	819	4	816
AZN43107.1	0.0	3	819	5	813
QHW31016.1	0.0	2	820	4	815
QGQ98288.1	0.0	2	819	4	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DKW_A	3.02e-18	14	731	59	744	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKW_B Chain B, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKX_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKY_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]
7DKS_A	1.57e-17	14	731	59	744	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKT_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKU_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKV_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]
5FJS_A	2.69e-17	14	731	55	740	Bacterialbeta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5FJS_B Bacterial beta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5O0S_A Crystal structure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with unreacted beta Cyclophellitol Cyclosulfate probe ME711 [Thermoanaerobacterium xylanolyticum LX-11]
5BVU_A	2.73e-17	14	731	59	744	Crystalstructure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],5BX2_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with 2-deoxy-2-fluoroglucoside [Thermoanaerobacterium xylanolyticum LX-11],5BX3_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with deoxynojirimycin [Thermoanaerobacterium xylanolyticum LX-11],5BX4_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with Glucoimidazole [Thermoanaerobacterium xylanolyticum LX-11],5BX5_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with glucose [Thermoanaerobacterium xylanolyticum LX-11],5NCX_A Crystal structure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase with an covalent inhibitor [Thermoanaerobacterium xylanolyticum LX-11],5OST_A Beta-glucosidase from Thermoanaerobacterium xylolyticum GH116 in complex with Gluco-1H-imidazole [Thermoanaerobacterium xylanolyticum LX-11]
5NPF_A	2.73e-17	14	731	58	743	Crystalstructure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with beta Cyclophellitol Cyclosulfate probe ME594 [Thermoanaerobacterium xylanolyticum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5M868	1.06e-17	14	658	144	780	Non-lysosomal glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba2 PE=2 SV=2
Q69ZF3	9.59e-17	14	658	144	780	Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
Q9HCG7	2.31e-14	14	658	153	789	Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
Q7KT91	4.74e-13	3	724	107	891	Non-lysosomal glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=CG33090 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003147_01946.