CAZyme Information: MGYG000003147_02611

Basic Information

• Species: Robinsoniella sp900555455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900555455
• CAZyme ID: MGYG000003147_02611
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753	MGYG000003147_17|CGC1	83352.43	4.7933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003147	4940098	MAG	United States	North America

• Gene Location: Start: 32337; End: 34598 Strand: +

Full Sequence      

MNVKEIVKQMTVEEKAGLCSGQDFWHTKAVERLGIPAIMVSDGPHGLRKQDQEADHLGIN
ESIKAVCFPAGCALAASFDRGMTTRLGEALGVECQAENVAVILGPAVNIKRSPLCGRNFE
YYSEDPYLASEIAASHIKGVQSKNVGTSIKHFLANNQEHRRMSSSSEMDERTAREIYLAA
FEGAVKQSRPWTVMCSYNRINGIYACENKKYLTDILRDEWGFDGFVVSDWGAVNVRVESL
KAGLELEMPSSFGINDKKITEAVKSGRLSEECLDEAAERVLNIVYKFVENRDENAVFDRE
ADHKLSKEIAAECMVLLKNDNILPLDEKSDTVFIGAFAKKPRYQGGGSSHINSFKVESAL
DASAGMEHITYAPGFITEEDVVDDALIQEAVEAAKKAETAVVFAGLPDSFESEGFDRRHM
RLPDCQNELIRQVAAVNPNTVVVLHNGSPLEMPWIQDVKAVLEAYLGGQAVGAATVDILF
GKANPCGRLAETFPLRLEDNPSYLYYLGEGDKVAYREGVFVGYRYYDKKKMDVLFPFGHG
LSYTNFSYGNLKLDKDSMKDTDMLSVSVDVTNTGTMKGKEVVQLYVSPLNSSMIRPVREL
KGFEKVELNPGETKTVHFELGKRAFAYYDMEVGDWAVESIDHEIQIGKSSRDIAAAAKVH
VESTKKKARSYDRNTTFGDLMKDEKTMEIAESILKGMAVLGDAGDDALGESTSAMNEAMM
MYMPIRGALTFGQGNISEEELEELLEKINRITD

Enzyme Prediction     

EC	3.2.1.21	3.2.1.37	3.2.1.23	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	249	3.1e-70	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.47e-106	3	656	38	760	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	4.90e-73	314	523	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
COG1472	BglX	6.17e-69	22	349	47	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.13e-67	6	618	56	740	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.98e-38	32	283	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18561.1	0.0	1	751	1	758
QHQ63232.1	0.0	3	750	6	755
QUI21624.1	0.0	3	749	2	754
QUC66582.1	0.0	1	750	1	754
QUA52387.1	0.0	1	749	1	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	7.60e-308	1	751	3	754	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.57e-204	2	705	4	702	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	1.24e-144	2	662	5	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.24e-141	2	662	5	837	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	1.95e-127	3	653	4	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	2.93e-307	1	751	3	754	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	9.87e-197	7	734	9	740	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.58e-195	7	734	9	740	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P27034	2.73e-146	3	661	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q5BB53	2.67e-145	1	656	4	826	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003147_02611.