CAZyme Information: MGYG000003147_03176

Basic Information

• Species: Robinsoniella sp900555455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900555455
• CAZyme ID: MGYG000003147_03176
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	MGYG000003147_24|CGC1	76098.63	5.7559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003147	4940098	MAG	United States	North America

• Gene Location: Start: 68370; End: 70364 Strand: +

Full Sequence      

MGNIRYRQIHLDFHTSEYIPEVGKDFNKEEFADTLVKANVDSITCFARCHHGWLYYPSKK
FPELIHPDLTNHNLLLEQIEACHEKGIKVPIYTTAQWDGRIMREHPEWLAVDENGEYIDT
QHVPAPHFYHTICLNSGYREFFKEHLEDMIDVVGADKVDGIFMDILFQVDCKCEHCVKKM
EELHVDVESKAARLRYSIHMLEEFKSEISAFIRERAPKASIFYNSSHVGPAYKDSFKDYS
HLELESLPSGGWGYDHFPATSRYARNLGKEMIGMTGKFHTYWGDFHSLKNRAALELECFS
MLAMGAGCSIGDQLHPNGKLSPGAYDLIGQVYGSVKEKEPYCRSASSVSEIAVLTPEEFY
PEEEYDLGISPSLIGTVRMLQELSYQFDIIDSQMPMDQYKVVILPDCIYYNADLDKVMKD
YIAKGGKVIGSFDSCIPKDGSENIYGVKYLGESKFYREFVMPNEVIGKDLPKEEFVMYLR
GFDVEPAGAEVIMDKIEPYFDRIGKTFCSHQHAPSSGKAGYPAVTRNGNAVYFSHPIFHL
YRKNAARWCKLMVKDALDLLLEHKLVNHDGPSTLISSLNHQEAENRDILHLLHYITEKRS
EDIYTVEDVIPLYMITMKLYVGEKKVQSVSLVPENNAVSFKQEGQYITFTLQEVKGHNMI
SIQY

Enzyme Prediction     

EC	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	28	165	3.5e-51	0.9847328244274809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14871	GHL6	7.16e-50	27	165	1	135	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
pfam08532	Glyco_hydro_42M	5.26e-04	378	532	37	183	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
pfam14885	GHL15	5.74e-04	91	164	29	96	Hypothetical glycosyl hydrolase family 15. GHL15 is a family of hypothetical glycoside hydrolases.
cd11335	AmyAc_MTase_N	0.001	79	149	150	215	Alpha amylase catalytic domain found in maltosyltransferase. Maltosyltransferase (MTase), a maltodextrin glycosyltransferase, acts on starch and maltooligosaccharides. It catalyzes the transfer of maltosyl units from alpha-1,4-linked glucans or maltooligosaccharides to other alpha-1,4-linked glucans, maltooligosaccharides or glucose. MTase is a homodimer. The catalytic core domain has the (beta/alpha) 8 barrel fold with the active-site cleft formed at the C-terminal end of the barrel. Substrate binding experiments have led to the location of two distinct maltose-binding sites: one lies in the active-site cleft and the other is located in a pocket adjacent to the active-site cleft. It is a member of the alpha-amylase family, but unlike typical alpha-amylases, MTase does not require calcium for activity and lacks two histidine residues which are predicted to be critical for binding the glucose residue adjacent to the scissile bond in the substrates. The common reaction chemistry of the alpha-amylase family of enzymes is based on a two-step acid catalytic mechanism that requires two critical carboxylates: one acting as a general acid/base (Glu) and the other as a nucleophile (Asp). Both hydrolysis and transglycosylation proceed via the nucleophilic substitution reaction between the anomeric carbon, C1 and a nucleophile. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
cd03143	A4_beta-galactosidase_middle_domain	0.002	380	434	35	89	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET99554.1	0.0	1	664	1	664
QRT30085.1	0.0	1	664	1	664
QHB23844.1	0.0	1	664	1	664
QEI31348.1	0.0	1	664	1	664
QEY34430.1	0.0	1	664	1	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVK_AAA	2.10e-143	4	664	30	687	ChainAAA, Alpha-L-fucosidase [Paenibacillus thiaminolyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003147_03176.