CAZyme Information: MGYG000003147_03240

Basic Information

• Species: Robinsoniella sp900555455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900555455
• CAZyme ID: MGYG000003147_03240
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702		81106.42	5.1628

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003147	4940098	MAG	United States	North America

• Gene Location: Start: 1101; End: 3209 Strand: +

Full Sequence      

MDAIQNLAKRVLPRHWEQINFERVQAVGEKDVYEVDTLRGKLVIKGNNYISMATGLGWYL
KHVANCNLSWCGCRMELPTLLPPVAACNRTVIEQKYRVYMNYCTFNYSASWWKWDRWEKE
IDFMALNGINMPLSVVGIEGVWRDTLTEFGFTDEEARKFLCGPAFLAWQWMTNIEGFCGP
LPTKWIESHVDLGQKIIERERSLGMQPIQQGFSGFVPLLLKEKYPDANIMKKEEWFGLPA
TGQLDPTDPLFDKLGTLFLQKQKELFGTYGFYAIDPFHESEPPLNTKEYLEAVGDSVKKL
LTNFDQNGVWVAQSWSIRHDIVSRMDKKNLLILDLCGEKHTETDNFWGYPFVTGTLHNFG
GRTNLHGDLQMLSANPYKTVSKIAPNVCGAGLFMESIGQNPAYYDLAFTQLTGGQKVDLS
EWMDKYMQRRTGIDSAEVRKAGEILLKTVYMPGTNGVEKSSIVAARPAVRVKKSGPNDGF
HYPYGNRRLFSALKLLMSARVNSDGARYDVVDILRQVLSNYGQALYVKVADAFLNRDAQA
FKTESESFLELLSDMDILLSSRSEFRLDKWIGDARRWGETLEEKEYYEWNASVLLTLWGT
TDCTHIFDYAWKEWSGMIELFYKQRWIKFFEMLARCLENDEEYVEDDLPQIFERQAWRAN
EFYNTLADWETAWTTQTKSFSENKPDELEIVITLISKYENRI

Enzyme Prediction     

No EC number prediction in MGYG000003147_03240.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	40	692	1e-202	0.9879336349924586

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	4.04e-144	97	408	1	327	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	8.08e-78	422	691	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	1.28e-28	2	82	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48266.1	1.94e-255	1	698	23	724
QDO68352.1	7.01e-254	3	698	27	726
QQT79630.1	7.25e-253	3	698	25	725
QUU09704.1	7.25e-253	3	698	25	725
ASM67128.1	7.25e-253	3	698	25	725

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	3.62e-114	1	639	171	830	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	4.31e-114	1	639	179	838	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	4.47e-113	1	639	194	853	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	4.44e-105	44	634	54	660	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	2.24e-112	3	698	48	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	5.96e-104	44	634	77	683	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003147_03240.