CAZyme Information: MGYG000003148_00470

Basic Information

• Species: Faecalimonas sp900551895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Faecalimonas; Faecalimonas sp900551895
• CAZyme ID: MGYG000003148_00470
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1450	MGYG000003148_2|CGC1	159296.31	5.0092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003148	1849841	MAG	United States	North America

• Gene Location: Start: 212504; End: 216856 Strand: -

Full Sequence      

MKRKQVVSLLLTVALVGSSIFSGTATLSVSAKETEGVTAEDLTDKNTAAPKKDKVIPSAN
QYKYQKDELAAFCHFGMNTYTGSEWGNGKEKPEQFALKNDFDAETLVKTLHDAGFKKLIV
TAKHHDGFCIWPSEYTEHDSQTAGYKGDVLAEISAACTKYNMDMGLYLSPWDVNAKSYGY
YDDKGNPLCDDKGKPLNNKTWEEVEKLDVDDYNEYYNNQLKEILGNDKYGNKGHFVEVWM
DGAKGSGSAVQNYTFEEWFDTIQQYEGKKSGKYDDDCMLFGAEAYTTVRWIGNENGFADS
ETWSKSKVDKNKNTIDSNTSNGYTKGFVDGNQWTVPEADARITSGWFWGEGKKAPKDMKA
LSEMYFRSVGHNAPLLLNVPPNKEGKVDTAILNRVTEFGNGIKNTFKDNLAKGAKVTAST
VRGNDTKFSPQNVLDGKDDTYWTVDDNAKTGTLTIDLGGVKTFDVVSVEESIEFGQRIGS
YKIEYETENGEWKKFDEGKTIGAKRLARKNAVKGKKVRITVTADEKAENKVPMLSEIGVY
KATDDMALGNGIPEGLEITDDRKFTATGWNQESGDQFIEGTGIWCEPKKEATVKFKGTKA
WLVGTVDPNHGPADIYIDDKKVASINTKGTSRQLGQRIFESETLEDKEHTLKIVNTGTDK
QAIGIDALLSLNNGGKGMLDIEYPSYRVNEDSKVPIKVKRVGGAKGETKVTFQVNPGSAW
QDHFNADGNMELTLKDGQTEAEAYVETKRVPAKTGDLSFTAELVNPSNGVITGFNTPSRI
TIADSEEFDKTAVEKKLDEVKKANYKAEDYTASSYKALQDAIQFAEKVVKKAKPSAQECA
EAVGKLDAAVRSLAKRTTYTTEDPYQLPKRKGSKKNLEAEHFILDKGTSATDKYVRIEKD
TNASNGQKVGWFENGNQIKLPFYAEKEGTYTFKAKLQSGRREDNPNALNWSGTNVQSGTI
NVHNNGDANGYKEVEFDVKVSKAGAGELIFTADEKASPNLDKFEVTAKEVAMGKFDITAE
ASENGKISPSGKVEVDEGTSKEFTMQPNEGYMVKDVVVDGESVGNVLKYKFEDVDANHTI
QVSFEKEKITADNRFEFPVEGEKRLEAERLELHNTGDANEQWKLEVANGDWASNGKFVNS
LNKDDEIKLYYNAEKAGDYAVIVTYRSGSAENGFSWSEKDGKIENGTVTMGATDSTKTHQ
QEITFKVKTAGEGVLTIKGGEKGAPQIDKFDIVSPVKELQVSALEKAIADGDKVVLDDYK
DGAAKDAFVKALKDAKDVFEKAKAGNCTQEEIDNAAKALTSAMEKLEEKDQIPAPDKSAL
KTAIDKAEGLDLTKYQNGAEKDAFVKALEKAKEVYKNDKATEEEISKATLELNSAMDKLK
PIESSNNGGNENNNGNQNGSQQTPQGNGNHSSAQKPSSPVKTGDTAEPFGYMAGMAAGLV
AVVALLRRRK

Enzyme Prediction     

No EC number prediction in MGYG000003148_00470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	37	400	3.6e-58	0.9190751445086706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.16e-62	57	540	11	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	2.18e-23	57	400	12	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	5.34e-22	100	400	83	326	Alpha-L-fucosidase.
pfam00754	F5_F8_type_C	1.21e-13	415	537	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd04080	CBM6_cellulase-like	6.59e-06	877	1006	5	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
PLT74914.1	0.0	4	1255	15	1265
QRT29448.1	0.0	4	1277	15	1296
QHB23055.1	0.0	4	1277	15	1296
QEI30547.1	0.0	4	1277	15	1296
QPK81604.1	1.97e-275	37	1004	33	1001

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TR3_A	6.00e-222	40	580	12	552	Ruminococcusgnavus GH29 fucosidase E1_10125 in complex with fucose [[Ruminococcus] gnavus E1]
6TR4_A	9.29e-221	40	580	12	552	Ruminococcusgnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1],6TR4_B Ruminococcus gnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1]
6ORG_A	2.21e-105	56	541	10	449	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6OR4_A	2.79e-104	56	541	10	449	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6ORF_A	2.88e-104	56	541	10	449	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORF_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	6.11e-86	56	540	37	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	3.35e-75	56	540	39	476	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P49713	3.04e-07	64	399	34	339	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001043	0.984672	0.013468	0.000362	0.000245	0.000187

TMHMM  Annotations     

start	end
7	29
1429	1446