CAZyme Information: MGYG000003152_01716

Basic Information

• Species: Prevotella denticola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella denticola
• CAZyme ID: MGYG000003152_01716
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1249	MGYG000003152_12|CGC3	141266.26	5.7245

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003152	2774939	MAG	United States	North America

• Gene Location: Start: 44043; End: 47792 Strand: -

Full Sequence      

MEKNRRIDCFIPDGSFDAIMSNSAQLWQTGVVQQIHLLVEKHQVMEIMPLHTDLLRIGRL
LSSDTMRLMAAYAGGEYTLLYLKRGPVTLGSHAVERMLQVAEETAAVMVYADRYAVEDGK
TVKHPVTDYQLGSVRDDFDFGSVVLLKTEYLKAYVTREAAEDWEFAGWYDLRLYLSRCGK
LFHLAEYLYTEEEDDLRASGVKQFDYVDPRNREAQMEMERVATEHLSSIGALVDMAHYEQ
PDFYEESFPVKASVVIPVFNREKTVRDAVVSALSQKTDFAFNVIVVDNHSTDGTTEILES
FRNDERLIHLAPDRTDLGIGGCWNYAIHDVHCGRFAVQLDSDDLYSSENTLQTIVDAFHE
QKAAMIVGSYRMCDFDLNTLPPGLISHSEWTADNGCNNALRINGLGAPRAFFTSLARQLR
FPNTSYGEDYAMGLAFSRRFRIGRIYDELYLCRRWGGNSDAVLSIDKVNVNNHYKDQLRT
IEILARQKQNREREKGLTEFFHNQLEQWSDAARRYEELKCVQTREAGPVLVQFNPARLVS
TGAKIDKASLANRPCFLCGKNRPAEQTALPFCDDFDILVNPFPILPAHFTIPACKHQPQA
IAGNYVQIHRLLRAYPQLMVFYNGPKCGASAPDHLHFQAGTSGILPLQRDWQQLRKTAEP
LLKLNNTEGIYEIKDYVCPALAIVSRTEAHDAALFSYVYEALPLKEDETEPMMNIVAWRS
GDAFVTVVFPRAKHRPDCYSAEGETQCLVSPGSLDMAGLLILPRQSDFERMTGERARAVL
REVSLSDEAMAEVVKQVRNEAVDAAFDDWRTEPVVSVGILSGKEIRFRLNGAYILGNRTV
SGEQTVKLMEGKMLWGFGRYQELSFTPADDDASFTLEDVTIGADFHWERKEEQTFVGSLQ
LVIDGDKIWAVNVLPVERYLASVISSEMRATSSLELLKAHAVISRSWLLVQMRRRKAIEM
GVQKAFAPVKVSEGEGIVWYDGDAHKLFDVCADDHCQRYQGITKATSPHVEEAIRATRGV
LLMDGSKICDARFSKCCGGVTEEFQYCWDNIRKPYLHSVADKAPLGTAPSEDLTEEKAAR
TWILSSPEAFCNTEDTAVLHQVLNNYDQETHDFYRWTVDYTQEELSELIRRKSGFDFGEI
IGLQPLERGRSGRISRLKIVGTKLTRIIGKELEIRRVLSESHLYSSAFVVDARDVVNGVP
RHFHLAGAGWGHGVGLCQIGAAVMGEKGYLYDEILHHYYQTAVIEKRYK

Enzyme Prediction     

No EC number prediction in MGYG000003152_01716.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	253	383	1.4e-20	0.7529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	1.80e-99	604	791	1	188	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
TIGR02669	SpoIID_LytB	1.19e-44	910	1246	2	267	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
COG2385	SpoIID	4.68e-34	911	1245	139	391	Peptidoglycan hydrolase (amidase) enhancer domain [Cell wall/membrane/envelope biogenesis].
TIGR02870	spore_II_D	4.00e-27	910	1246	68	337	stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination]
pfam08486	SpoIID	7.58e-26	905	1023	2	100	Stage II sporulation protein. This domain is found in the stage II sporulation protein SpoIID. SpoIID is necessary for membrane migration as well as for some of the earlier steps in engulfment during bacterial endospore formation. The domain is also found in amidase enhancer proteins. Amidases, like SpoIID, are cell wall hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB88719.1	0.0	1	1249	1	1249
AEA20835.1	0.0	1	1249	1	1249
QUI94464.1	0.0	1	1249	1	1249
QUB90404.1	0.0	1	1249	1	1249
AXV48358.1	0.0	1	1249	1	1249

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I1T_A	2.03e-08	914	1248	64	330	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]
5TXU_A	2.33e-08	914	1248	88	354	ChainA, Stage II sporulation protein D [Clostridioides difficile 630]
4RWR_A	1.93e-06	898	1245	50	318	2.1Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis],4RWR_B 2.1 Angstrom Crystal Structure of Stage II Sporulation Protein D from Bacillus anthracis [Bacillus anthracis]
5TZE_C	2.96e-06	250	359	1	112	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	4.29e-06	250	359	1	112	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0QYX7	1.37e-07	895	1239	88	346	Uncharacterized protein BHWA1_00569 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) OX=565034 GN=BHWA1_00569 PE=1 SV=1
P07372	6.60e-07	910	1246	71	331	Stage II sporulation protein D OS=Bacillus subtilis (strain 168) OX=224308 GN=spoIID PE=4 SV=1
O32268	1.06e-06	253	439	9	189	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
O06483	3.28e-06	250	367	1	114	Uncharacterized glycosyltransferase YfnE OS=Bacillus subtilis (strain 168) OX=224308 GN=yfnE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003152_01716.