CAZyme Information: MGYG000003154_00306

Basic Information

• Species: UMGS1490 sp900548185
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; UMGS1490; UMGS1490 sp900548185
• CAZyme ID: MGYG000003154_00306
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		39415.7	7.1264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003154	2438738	MAG	United States	North America

• Gene Location: Start: 78500; End: 79540 Strand: +

Full Sequence      

MAIRTPLIIAALFGTALLNAQDARFEPAPSDSPSRFQREQIQRKYGMFIHFGINTFHNQE
WTDGTKPAASYAPSAIDARQWVETAKNAGMKYIILVAKHHDGFCLWDSACTQYDVASSGN
PTDVVDAVARECARQGIGLGLYYSLWDRNRNPDVADPSKDEAYNRYMLAQIGELAAIVQR
HTKLLEFWFDGGWEKPKQRWPIAEIYRAIKTAAPQCQVGVNWTIEIPGDPKKHVGPAEQK
EGYPIRYFPSDFRLGDPCLPEFPDPKLFTHGGRTYYMPWESTVCISGKWFYHTEDDAYKS
VDELAAIYRRATAQDNILILNAPPNREGRIREKDVQLLLKLREKIQ

Enzyme Prediction     

No EC number prediction in MGYG000003154_00306.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	41	342	6.3e-69	0.8323699421965318

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	8.04e-43	20	341	2	326	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	2.80e-42	44	339	26	322	Alpha-L-fucosidase.
COG3669	AfuC	3.35e-37	33	346	11	313	Alpha-L-fucosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ35196.1	3.05e-166	27	345	26	345
QTO26593.1	3.05e-166	27	345	26	345
QCQ30777.1	3.05e-166	27	345	26	345
ATP59154.1	6.89e-165	17	345	17	347
QOD59462.1	8.48e-165	27	345	26	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	2.24e-46	23	338	28	345	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
6ORG_A	2.94e-38	33	338	11	312	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
3EYP_A	5.28e-38	33	334	10	308	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
6OR4_A	1.49e-37	33	338	11	312	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6ORF_A	1.51e-37	33	338	11	312	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORF_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	3.23e-42	1	343	1	339	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	4.80e-37	15	338	24	333	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
P17164	2.22e-12	42	221	51	258	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
P49713	4.13e-12	44	330	38	327	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
P10901	3.03e-11	44	341	41	349	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999067	0.000209	0.000152	0.000156	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003154_00306.