CAZyme Information: MGYG000003155_01150

Basic Information

• Species: CAG-495 sp900551585
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp900551585
• CAZyme ID: MGYG000003155_01150
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587		67122.53	10.117

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003155	1685607	MAG	United States	North America

• Gene Location: Start: 1552; End: 3315 Strand: +

Full Sequence      

MKRFCLSFCLTILLAFSFVLLEGQKEAAAGQEIIDRRATGKIYSYLMVSDSDIARYKRIF
RAIKAEDFKTADKEIAKLDNDILMGRVLAQKYLSDSYKTSFGELKSWLEKYGDHPEALKI
YRLALRKGKSKDVVCPDRAKIKPSGFYSWANTDLANLKPADKTFVLNKINVFRKAINSGK
TKVARYVLENPRFKKLVPNRDLDAMAATLAMKYLLDNNDALAQQWASKASKRSNDATASW
VAGLASWRLKQYKTAAIYFERLARSGNSDEWLVAAGAYWAYRANTVSNRKTQAFQWLKVA
SRYKRTFYGILANYRLGASLDYNWTVLSYLNDFSQDEYIDEILASSSIRRAMLLLHAKQP
ELAEQELRYDYNNMNEKQKEVSLFIANQFKMHSLAVMISNNLKDEERNIAYDALSYPIPN
WKPKGGWQIDKALVLALTRQESAFSPKAKSAAGACGLMQLLPSTAAHITKNTSLKKDNSP
LLEAEYNMALGQKYVNYLLEKPFIDGNLFYLMTAYNAGPGNLLKWSKKAKFNDDPLLFIE
VIPARETRIYIERVMANYWIYQSRFGQELTGIKALSKGKWPMLKYKK

Enzyme Prediction     

No EC number prediction in MGYG000003155_01150.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	432	560	3.4e-21	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	7.85e-50	416	564	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.75e-33	432	559	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	1.77e-32	428	558	16	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	6.88e-28	289	567	9	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK11619	PRK11619	3.12e-24	173	580	242	640	lytic murein transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10634.1	2.02e-162	32	583	26	577
CDL00242.1	4.19e-115	48	582	75	603
AVM75780.1	2.33e-114	48	582	75	603
AVM79683.1	2.33e-114	48	582	75	603
AMW33857.1	4.39e-109	47	582	58	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	2.04e-22	426	579	463	616	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	3.49e-21	426	579	463	616	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5O1J_A	1.25e-19	268	566	275	564	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.64e-19	268	566	271	560	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	1.69e-19	268	566	281	570	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	1.20e-21	426	579	490	643	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.20e-21	426	579	490	643	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	2.11e-21	426	568	490	632	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	1.30e-15	395	559	39	180	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P44888	1.43e-15	263	562	292	573	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.011054	0.925605	0.062433	0.000338	0.000264	0.000275

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003155_01150.