CAZyme Information: MGYG000003155_01165

Basic Information

• Species: CAG-495 sp900551585
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp900551585
• CAZyme ID: MGYG000003155_01165
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252		29414.26	8.1273

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003155	1685607	MAG	United States	North America

• Gene Location: Start: 2070; End: 2828 Strand: -

Full Sequence      

MYDSFWFEEINKSTKARATKRNYELKVFNADVPLASRRQIEKCANKGLARFLPKFLTGRS
GRVIKENCAFSYYEEFLSVKDDAYFAGVFANNCYFDNYRRELLQAFSLKDEMSEANNAML
QEIINTNSVSVHIRRGDYVKLGLTCNLDYYYQAINYINSKVEDAHFYIFSDDVAWVRDNL
KLDNPHTFVDINDGKTGFCDLELMKNCRHNITANSTFSWWAAYLNQNPRKIALAPKDKSD
DKFRFLFKGGYC

Enzyme Prediction     

No EC number prediction in MGYG000003155_01165.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	26	243	1.5e-57	0.7536231884057971

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	4.61e-52	62	242	68	259	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.52e-28	92	243	123	283	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	8.93e-06	93	230	125	286	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYR22730.1	2.91e-45	21	236	44	272
AKF24141.1	3.90e-45	21	241	44	275
ADE13114.1	1.12e-44	18	236	42	272
ACU02372.1	1.25e-44	27	242	51	268
AZZ36566.1	3.68e-44	49	235	74	262

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	3.85e-23	17	236	44	283	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
O77485	2.26e-13	85	248	147	321	Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Pan troglodytes OX=9598 GN=FUT2 PE=3 SV=1
O77486	2.26e-13	85	248	147	321	Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Gorilla gorilla gorilla OX=9595 GN=FUT2 PE=3 SV=1
Q10981	2.26e-13	85	248	147	321	Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Homo sapiens OX=9606 GN=FUT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003155_01165.