CAZyme Information: MGYG000003158_01158

Basic Information

• Species: CAG-485 sp000437495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp000437495
• CAZyme ID: MGYG000003158_01158
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598	MGYG000003158_17|CGC1	67257.61	10.4946

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003158	2372676	MAG	United States	North America

• Gene Location: Start: 38282; End: 40078 Strand: -

Full Sequence      

MKTGTHSVMKTALKKGSHSSHHSHNSHNSQNSRSSDRLRGEWRGQKGMARWWRPVVLAVV
CFFTFFVNNGVLVPDIMESRNLITAREMVAKGNYLVPTMNGELRLAKPPLPTWIAAAVEE
ASPDNIVAQRCAAGVAGVMLTIFLYLLAARITRIDPLWPTLLLLTCYNVVLMGRTASWDI
FCHAFMLGGIYFLARALLEPGRQTASFCWAGIFTGLSIMSKGPVSLYAMLLPWLIATLCC
RRVNMRGKWSGVAVLVIVALLTGGWWYAYIYLQHKSELQAVAAQESGAWMNRNVRPWWYY
HKFYLETGIWALLLISAIVLAFTRRVRRYRGFYTPLVWMLAALVLLSVLPEKKMRYLLPV
LVPAALVMGQLICRWIEEFRRPSAASRADKVIFRLNAWLLAIVTLALPVAAWYFCYRPGY
MALWALVLMALVSLVVAVCIGFAAVRLAPGGMVWGVAVLFVLAEGIGLPAVKPLINNADM
RSVRLIADRSDLRGVPFFSNAADELRIEMVYAARRDITPVAFTDSALQRLPLPAVILTHR
GAKAELPADFLQRVDTVYIGRFDDNRRPEKSGRYNPKFIYHLTYLRPKTAAPEHTKNK

Enzyme Prediction     

No EC number prediction in MGYG000003158_01158.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	48	475	9e-58	0.8037037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.16e-18	52	562	9	508	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.11e-09	74	460	31	424	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	5.77e-09	107	265	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU70216.1	2.89e-20	77	470	50	468
ARQ76963.1	8.23e-19	46	406	12	368
SDU05181.1	8.31e-19	46	406	15	371
QPC33696.1	8.31e-19	46	406	15	371
QPL29692.1	1.42e-18	46	406	15	371

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3KCC9	4.81e-17	50	378	22	356	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
Q4ZSZ0	5.78e-16	69	405	27	362	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
Q4KC80	4.14e-15	50	405	4	361	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1
Q4K884	5.93e-15	48	420	35	404	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
O67270	5.99e-14	55	407	9	366	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999937	0.000062	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
51	73
126	148
176	198
213	235
248	270
303	322
329	346
356	378
391	413
423	445
452	471