CAZyme Information: MGYG000003158_01923

Basic Information

• Species: CAG-485 sp000437495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp000437495
• CAZyme ID: MGYG000003158_01923
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		45520.38	8.8872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003158	2372676	MAG	United States	North America

• Gene Location: Start: 704; End: 1942 Strand: +

Full Sequence      

MRITFINKSDSVGGAAVVTLRLVEALRQLGHDARLVVTDRRTDREYVALGGSEGRIRTAF
LADRLPLLLSNGFRRSTLFQIDAARAGLPLWRHDWVRNADAIVLGWINQGVLSLDGIRRI
GLLNKPLLWTLHDMWALTGVCHHAHDCQGYRRMCGNCQLLGGAASGNDLSAVMMERKRRL
YDRVDIQFVAVSRWLAEKARESTLLGEERVAVIPNPYPVQPMPRRKGSPTGHIVMAAARL
DDPIKGFPLLIEAVRALRRRNPQLTAGLHFDLIGEMRNPEAAKALEAEYTLHGMISDSAR
MRQLYAAADAVVSPSLFETLPGTLVEAQDCGAVPVAFDRGGQRDIIVPGKTGFIAPWNDD
PRRAGENFADSLVQALELAADPATPKLLHEAVVNNFAAEKVARQYVQLIENQ

Enzyme Prediction     

No EC number prediction in MGYG000003158_01923.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	230	359	8e-21	0.80625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03825	GT4_WcaC-like	1.01e-77	1	411	1	363	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.
cd03801	GT4_PimA-like	6.03e-39	2	410	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03823	GT4_ExpE7-like	2.01e-33	10	411	12	357	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
cd03811	GT4_GT28_WabH-like	3.02e-29	2	396	1	349	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
COG0438	RfaB	2.17e-27	1	410	3	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36841.1	2.77e-107	1	408	1	409
QCP72361.1	6.86e-92	2	408	19	426
QCD38673.1	6.86e-92	2	408	19	426
QCD41807.1	4.09e-90	2	408	23	430
QDO68538.1	7.51e-86	1	411	1	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BFW_A	3.05e-09	227	379	32	181	Structureof the C domain of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
3L01_A	3.36e-09	227	407	247	425	ChainA, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]
3FRO_A	3.45e-09	227	407	247	425	Crystalstructure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_B Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_C Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi]
2BIS_A	3.46e-09	227	407	248	426	Structureof glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_B Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_C Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
6KP6_A	1.56e-08	227	379	234	383	Thestructural study of mutation induced inactivation of Human muscarinic receptor M4 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71237	1.24e-06	124	346	123	345	Putative colanic acid biosynthesis glycosyl transferase WcaC OS=Escherichia coli (strain K12) OX=83333 GN=wcaC PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003158_01923.