CAZyme Information: MGYG000003160_00854

Basic Information

• Species: UMGS1858 sp900555705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1858; UMGS1858 sp900555705
• CAZyme ID: MGYG000003160_00854
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
661	MGYG000003160_97|CGC1	72656.78	4.1574

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003160	1773026	MAG	United States	North America

• Gene Location: Start: 3820; End: 5805 Strand: -

Full Sequence      

MVGAQAEKTGSDNATAFVEFTLQPQQTVYLVTAVGGGGRTYDNQNRLLSDTAPVEQAGAL
LEEAAGAADITALAAAHADWWKAFWLRSYISLDTDNADLQTLQRYYYGAQYLFGCMANED
GVAPGLYGVWHTTDTPSWNSDYHLNYNFISTFYGAFSSNRTALTRSAVQAILDYVPAAEK
AAQTISELRKVDSDFVNYKIEKGDIDPEKGIEGAVLFPVGIGPFGMILDANYHHQTLNAC
FSAALLIDYYDYTQDEDFLRNELYDYLRKCATFYEAWLEKEDGKYVLYAGYNEGSWAINS
AAELAMLKNVLQNLIEASEKLNRDADHRVIWQEMLDGLADQPTATFEGKTVYALAEQEYV
NGKWVDMANPVPGDGNIIPMESAEPGNQLGYYSSAEELAIARSTIDIFAARGAWSQNNNF
PKIFPIAVNTRYPAETIVAQFARVIREKMVANLRINDNTHGAEKSGATQAINDMLVLSDQ
GVIKLFGNWLADQDASFARLRTDGAFLLSAAYDGDRQEVTAASLYSEVGGTAIVASPWLD
MKVLDEDGKEIALTEGTAPNHDDELTYTFETEAGKTYTLVKGEKAQENEKPEGLLGDIDG
DKVVNTTDARLALQYAVEKITLDEAQLAAGDVDGDGIVNTTDARLILQKAVEKIDKFPAE
Q

Enzyme Prediction     

No EC number prediction in MGYG000003160_00854.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	22	535	1.4e-50	0.685595567867036

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14256	Dockerin_I	2.17e-14	595	649	1	55	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	2.75e-08	596	651	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14253	Dockerin	6.66e-08	596	651	1	56	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.
cd14255	Dockerin_III	1.53e-04	596	647	1	57	Type III dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. Two specific calcium-dependent interactions between cohesin and dockerin appear to be essential for cellulosome assembly, type I and type II. This subfamily represents the atypical type III dockerins and related domains.
cd14254	Dockerin_II	1.68e-04	596	649	1	52	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHW32096.1	8.27e-130	2	593	542	1092
QXE33659.1	7.36e-128	14	580	422	953
AWS40658.1	1.45e-123	11	580	392	927
BCB76148.1	1.51e-116	3	580	337	880
QKW17790.1	2.50e-76	20	554	251	755

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003160_00854.