CAZyme Information: MGYG000003160_00914

Basic Information

• Species: UMGS1858 sp900555705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1858; UMGS1858 sp900555705
• CAZyme ID: MGYG000003160_00914
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609		69142.63	4.8202

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003160	1773026	MAG	United States	North America

• Gene Location: Start: 1390; End: 3219 Strand: +

Full Sequence      

MMYDTLKKQTAVGYNTWDTTSVLSHVLLPYGLSIRLGFKDYVTGRVFRNVLIGDAIDGKE
LIHPGIRTYGGGYTELAFHHGSVHVRIQSAAVEDEQYLLITPLEFPEQDTVVRAPALVAD
LCMLWNRPGRVCREGNQLKAELADREITFSATGRLLDEYYTFSTNPYLAMELSGPIAISS
AACSLEEVQKTIEAARAKAEESAAKYGDQAECYAAMRTCLAWDTIYDPEHDRICSPVSRN
WNVRWGGYVLFCWDTFFAAAMAAVENKELAYMNILAILEEMTENGFVPNFGAAYDYKSRD
RSQPPVGSIVIRQVYDRYREKWLLEETFDRLFGWNTWFTNERTNADGTLSWGSNVYQPRI
GKHWERFAIHNHDGAAFESGLDNSPMYDGVPFNPDTNCLYLADVGLTGLYIADCEDLAYL
AAEIGRTEEQQVLLQRAQHAKDGMAALWSEQDGIFLNRRTDTGEFSRRLSPTNFYALFSD
RVSDEQATRMVKEHMFNPEEFWGDYVLPSIARNDPAFPDQNYWRGRVWGPLNYLVYLALC
RQNQPEARTALAEKSADLLLKEWRLHGHVHENYDSTTGMGCGVHNSDKFYHWGALLALIG
VLESEQPNA

Enzyme Prediction     

No EC number prediction in MGYG000003160_00914.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	228	597	4.7e-28	0.38596491228070173

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03200	Glyco_hydro_63	1.69e-13	497	599	377	491	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	7.23e-13	253	578	131	478	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PRK10137	PRK10137	1.87e-10	229	594	329	773	alpha-glucosidase; Provisional
PLN02567	PLN02567	5.84e-09	253	582	156	516	alpha,alpha-trehalase
COG3408	GDB1	1.16e-08	248	609	282	614	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK58860.1	1.65e-206	3	603	18	614
QTH44429.1	1.36e-202	3	603	17	613
QNI32096.1	2.60e-183	6	606	1	603
QTD47584.1	4.33e-175	13	604	40	625
QDO68990.1	2.08e-166	2	604	30	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.40e-11	379	599	568	799	Crystalstructure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
3W7S_A	1.21e-07	235	594	304	746	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	4.80e-07	235	594	304	746	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	6.32e-07	235	594	304	746	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.90e-06	235	594	305	747	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P53008	7.79e-11	379	599	598	829	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
P42592	6.72e-07	235	594	327	769	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003160_00914.