CAZyme Information: MGYG000003161_00210

Basic Information

• Species: Eubacterium_R sp900540305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900540305
• CAZyme ID: MGYG000003161_00210
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		38595.03	7.3198

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003161	2037503	MAG	United States	North America

• Gene Location: Start: 58499; End: 59485 Strand: +

Full Sequence      

MITLKPQNVPNENQQAQIDRKYGMFIHFGINTFNDTEWSDGKLPVSSYNPTEIDADGWVK
NAYEAGMTYVILITKHHDGFCLWDTKYTDYCVKNSPNKTDVVLETAKACKKYGIKLGLYY
SLWDRHEKCYKNHKKYVEYMCNQLTELLDGRYGEIVEVWFDGGWDKRAKNWNVEKLYDLV
HTLQPGCVCAVNTTIGNEMFKRTSSKYLPEKYKEGMPIKYFPSDFRLFDPYFTRDDDPKL
YKKNSNMYYLPFEATICIRNMKNWFWDPKYTSEKLIEAEFIAEHYRKLIAQKNVLVVNVA
PNTDGKQEQSDIDRLMEASEILGIKRTL

Enzyme Prediction     

No EC number prediction in MGYG000003161_00210.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	12	322	6.6e-70	0.8583815028901735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	4.50e-45	19	215	24	260	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	5.27e-45	19	220	25	260	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	1.20e-42	10	326	11	316	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam14871	GHL6	0.004	54	126	1	74	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBN20382.1	1.94e-116	11	325	27	336
QOD60739.1	8.29e-114	8	325	29	341
ATP59154.1	2.92e-113	6	322	29	347
QOD59462.1	3.37e-111	6	317	28	340
QRQ63551.1	1.59e-104	6	322	29	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	1.81e-54	9	320	31	350	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	2.02e-41	10	315	19	340	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
6ORG_A	9.62e-41	1	317	1	314	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
5K9H_A	1.65e-40	9	188	38	232	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
6OR4_A	1.33e-39	1	317	1	314	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	9.52e-53	4	321	27	339	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.44e-42	9	321	39	340	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q9VTJ4	3.47e-12	19	185	52	252	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
P10901	4.39e-12	19	182	39	243	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q2KIM0	8.40e-10	19	172	58	244	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003161_00210.