CAZyme Information: MGYG000003162_00110

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_D
• CAZyme ID: MGYG000003162_00110
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
687		79031.6	6.4338

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003162	1479112	MAG	United States	North America

• Gene Location: Start: 5951; End: 8014 Strand: -

Full Sequence      

MTKPVPKDYELPLYLFHEGSLYAAYDFFGCHPYELDGVKGHIFRVWAQKAEAVALVGDFN
NWDETANHMEQLGDTGVWELFVEGLKTYDSYKYAITGCDGVLRLKADPYGTHMGVAPATD
SKIFDIDGYQWSDKIYQDQKKKKNIYESPMNIYEVHLNSWKACETGKYYSYTNFANQIIP
YLLDMGYTHIEFMPLAEYPFDGSWGYQGIGYYAPCSRFGTPTDFMAMVDLFHAAGISVIL
DWVPAHFPRDAAGLFEFDGSASYEYADPKKRDHLSWGTRVFDYGRPEVRSFLISNAIYWL
DKFHIDGLRVDAVASMLYLDYDRRDGEWTPNEFGGHENLEAIEFFHKLNEAVFARDPQTL
MIAEESTAWPMVTKPVSDGGLGFNFKWNMGWMNDMLKYMAMDPIHRAFHHDMLTFSFFYA
FSENFILPISHDEVVHGKASLVNKMFGADTDMKFAQARLFMAYMTAHPGKKLLFMGSEFA
QFREWDYENGLEWFMIDEFEQHRNYQKFVRTLNNFYKDTPALWERDFSWDGFSWISNDDY
RQSIIIFRRFDNKGNEVIVVCNFVPVSRTSYCFGVPYEGEYTEVLNCTSPDGAPSTNGTV
KSKPVPMHGLEHSICIDIPAYSCMYFTVKKKKPRKKAAPKAKTETAKTSKTKTAAKKTAE
KSATAKKTASKTTRPTTKKSSVKKTVE

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	180	481	2.8e-151	0.9966777408637874
CBM48	28	111	1.5e-16	0.868421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	2	626	1	625	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	6	622	4	622	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	0.0	5	626	600	1220	glycogen branching enzyme; Provisional
PRK14706	PRK14706	0.0	1	624	1	617	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	10	626	102	721	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20809.1	0.0	5	637	4	636
CCO05861.1	0.0	1	642	1	645
CBK95803.1	6.91e-295	1	633	1	635
CBL34144.1	6.91e-295	1	642	1	643
CBL16844.1	4.72e-290	1	639	1	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1M7X_A	4.62e-204	18	625	4	611	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	6.30e-203	25	625	6	606	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
3K1D_A	7.58e-203	10	627	103	720	Crystalstructure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV [Mycobacterium tuberculosis H37Rv]
5GQW_A	1.48e-201	13	603	134	745	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQZ_A	1.48e-201	13	603	134	745	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	1.93e-229	1	626	1	625	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q1AZ86	3.62e-227	4	625	97	716	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
O66936	1.63e-220	8	625	9	625	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1
Q3JCN0	1.28e-218	4	629	109	733	1,4-alpha-glucan branching enzyme GlgB OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=glgB PE=3 SV=1
Q8DLB8	2.32e-215	6	632	104	754	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003162_00110.