CAZyme Information: MGYG000003162_01043

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_D
• CAZyme ID: MGYG000003162_01043
• CAZy Family: GT51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227		25361.14	4.3629

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003162	1479112	MAG	United States	North America

• Gene Location: Start: 2072; End: 2755 Strand: -

Full Sequence      

MTPSYCFNFLKEKLDITTLDEDFDPDYSAMTVGGLTNGLHLEELVGAYTIFGNGGRKYET
TYISKIEEVDGTVIYEHSDGYKQAISESTAFIMNKMMQQVVNNSEGTGRYARLNNTAVAA
KTGTSSDWVDLNFVGCTPDYVSGVWIGYEEWEKIPTNQYQNIGAIWKNLFGDIAENEKNH
DFLMPDDVVQLNYCTRSGNIAGSYCNSTGVGYYKKSAIPQTCSGYHY

Enzyme Prediction     

No EC number prediction in MGYG000003162_01043.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	4.66e-38	21	148	378	501	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.97e-37	19	189	447	614	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.41e-30	22	215	548	760	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.97e-10	29	198	430	585	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK09506	mrcB	8.75e-10	29	210	604	777	bifunctional glycosyl transferase/transpeptidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO04758.1	3.57e-109	1	226	512	740
ADU22273.1	6.11e-87	1	226	506	739
CBL16716.1	2.69e-49	7	225	575	794
CBK97274.1	3.98e-47	6	226	538	758
CBL33874.1	3.98e-47	6	226	538	758

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZG8_B	5.95e-18	12	182	294	469	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
7U4H_A	9.51e-18	24	227	614	815	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG7_B	6.49e-15	12	182	294	469	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
4OON_A	2.46e-14	43	191	541	740	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2V2F_F	3.09e-12	38	186	214	375	Crystalstructure of PBP1a from drug-resistant strain 5204 from Streptococcus pneumoniae [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40750	2.24e-18	24	147	474	596	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
A7GHV1	4.45e-18	19	221	490	693	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A5I6G4	4.46e-18	19	221	490	693	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	4.46e-18	19	221	490	693	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
Q97GR5	8.15e-18	18	224	514	700	Penicillin-binding protein 1A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003162_01043.