CAZyme Information: MGYG000003163_00009

Basic Information

• Species: Phocaeicola sp900546645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546645
• CAZyme ID: MGYG000003163_00009
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000003163_1|CGC1	36785.44	6.4974

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003163	2819390	MAG	United States	North America

• Gene Location: Start: 19148; End: 20125 Strand: +

Full Sequence      

MKIRTLFASLLVCAVQATFADSLQPKDDETRIYAQPEAPLVLKPGDAHPSVKGWKFFTAH
EFLDRDTEGKLPKGFVEHRGVHMSRSAKVDNACCSEVKDGVLHIYAREEADSIDNGFGKA
VKYSHGCYRSATPRDEAEMWCNFTENMRIEIRFKRTPYQGFNDALWFMGNNDRPWPANGE
IDLLENPKKKVNNRAHFTLHSENHYAGVMGGKGSVTATVELKDMSEWNIYWLEWYPDRIV
GGVNGKAYFTHTKGADDNLDWPWSDPAGFYLIFSTGISTNPKSWPGVINPAEWKKDGGPD
MCIDWVRVYVNEAYQGAPAPAVKFY

Enzyme Prediction     

No EC number prediction in MGYG000003163_00009.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	94	309	1.3e-29	0.8347826086956521

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	7.03e-29	97	309	42	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02182	GH16_Strep_laminarinase_like	2.56e-10	147	310	88	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd00413	Glyco_hydrolase_16	2.70e-10	148	309	69	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	2.63e-07	97	315	78	269	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
pfam00722	Glyco_hydro_16	3.19e-05	148	307	35	168	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBJ17909.1	1.81e-166	19	325	620	925
QUT89376.1	2.07e-166	25	325	507	806
ALJ59588.1	1.17e-165	25	325	507	806
QTD38739.1	3.38e-19	51	309	37	272
AIM36104.1	3.50e-19	50	309	38	274

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XOF_A	3.15e-12	149	309	115	266	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	1.44e-11	149	309	115	266	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
6T2N_AAA	1.64e-11	53	314	51	307	ChainAAA, Glycoside hydrolase family 16 protein [Akkermansia muciniphila],6T2N_BBB Chain BBB, Glycoside hydrolase family 16 protein [Akkermansia muciniphila]
6T2O_AAA	6.35e-09	148	308	112	272	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2O_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
5NBO_A	1.44e-08	160	308	124	271	Bacteroidesovatus mixed linkage glucan PUL (MLGUL) GH16 [Bacteroides ovatus],5NBO_B Bacteroides ovatus mixed linkage glucan PUL (MLGUL) GH16 [Bacteroides ovatus],5NBP_A Bacteroides ovatus mixed linkage glucan PUL (MLGUL) GH16 in complex with G4G4G3G Product [Bacteroides ovatus],5NBP_B Bacteroides ovatus mixed linkage glucan PUL (MLGUL) GH16 in complex with G4G4G3G Product [Bacteroides ovatus],6VHO_AAA Chain AAA, Glycosyl hydrolase family 16 [Bacteroides ovatus ATCC 8483],6VHO_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000459	0.998333	0.000600	0.000210	0.000184	0.000181

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003163_00009.