CAZyme Information: MGYG000003163_00132

Basic Information

• Species: Phocaeicola sp900546645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546645
• CAZyme ID: MGYG000003163_00132
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000003163_3|CGC1	42888.82	9.422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003163	2819390	MAG	United States	North America

• Gene Location: Start: 7624; End: 8763 Strand: +

Full Sequence      

MKYYLIAGEASGDLHASNLMKAILQEDPKAEFRFFGGDLMAKAGGTCVKHYRDMAYMGFI
PVLLHLRTIFRNLSCCKQDILTWKPDVLILIDYPGFNLKVAKFIKQHSSIPVYYYISPKI
WAWKEYRIKNIRRDIDKLLSILPFEVDFFKKHHYPVNYVGNPCVDAVQTFRENYQESLDE
FQLRNKLDNRPIIALLAGSRKQEIKDNLSRMTEASKDFPQYQFVVAGAPGIDPEFYQQFI
GKDTKILFGQTYPLLTHATAALVTSGTATLETALFKVPQVVCYYTTAGKLVSFLRRHILK
VQYISLVNLISGNEAVTELVADGMTVTNLKAELKQILPDGNKRSKMLSDYEQLIQTLGTA
GASQRAAEIIISSLSGGKK

Enzyme Prediction     

No EC number prediction in MGYG000003163_00132.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	6.8e-112	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	7.99e-110	1	379	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.05e-100	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.01e-73	4	369	2	370	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.47e-66	5	371	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.61e-48	1	370	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23865.1	2.60e-203	1	374	1	374
ADY36062.1	1.89e-197	1	379	1	379
QQY38221.1	1.32e-182	1	374	1	377
QUT59470.1	1.32e-182	1	374	1	377
QQY41518.1	1.32e-182	1	374	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	6.99e-37	5	371	11	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.99e-37	5	371	11	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	1.18e-64	5	379	11	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	9.74e-63	5	372	8	376	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	2.72e-62	5	378	9	382	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q74AT9	1.54e-61	5	374	11	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q6ALW0	4.11e-58	5	374	14	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003163_00132.