CAZyme Information: MGYG000003163_00373

Basic Information

• Species: Phocaeicola sp900546645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546645
• CAZyme ID: MGYG000003163_00373
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221		25544.39	9.8849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003163	2819390	MAG	United States	North America

• Gene Location: Start: 54108; End: 54773 Strand: +

Full Sequence      

MHNIILTAVLLILGSASASAQFYTITKETEIRPEKQQKVAPDTLQRGLVAFESCKKAEKD
SRAPEVPVKLLSELYARKVYARVSHEKASDKGTEKTEVSERKELPALTIPNLYQEIIRNG
IRHPKIVLAQAILETGWFRSPLCRNRHNLFGLTNPKTGKYYEFNHWTESVRAYYTKVQYR
YCQKNQTSTSDVDYLKWLQQIGYAEAPMYIQSVKEIMKRNL

Enzyme Prediction     

No EC number prediction in MGYG000003163_00373.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	120	220	2.4e-20	0.890625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	1.69e-15	110	174	2	78	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG1705	FlgJ	3.70e-10	118	220	60	182	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	4.91e-10	128	221	186	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	3.94e-06	118	218	25	137	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK12711	flgJ	8.37e-05	124	216	237	354	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRN01429.1	4.60e-97	1	217	1	205
QQY36875.1	2.65e-96	1	217	1	205
QUT98797.1	7.18e-66	1	218	1	209
QRN01359.1	2.47e-65	1	218	1	205
QJR77087.1	4.57e-64	1	218	1	209

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000423	0.998877	0.000172	0.000180	0.000166	0.000156

TMHMM  Annotations     

start	end
4	26