CAZyme Information: MGYG000003164_00084

Basic Information

• Species: CAG-485 sp002361235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp002361235
• CAZyme ID: MGYG000003164_00084
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		70726.63	5.8773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003164	2929430	MAG	United States	North America

• Gene Location: Start: 112890; End: 114752 Strand: +

Full Sequence      

MALLLLVCGMAQAADEATVLKLTSPDGVNEVTFSKPGRELTWQVRMNGADVILPSRAGLD
LDNRVWEMALGKRDLQQPECWMDLLTVDSVRVHQPVDNEWHPLYGERSTVRDRYNSATMY
MSRHDKSKYRLNVEVRAYDEGIAFRYFFPEHPDAIFHKVTADLTDYTFPAGTMAWSEQWA
QAKFDRTGIDEIKQPVERALTLELPDGKWVAVTDADVDDWCLTKFVARDGKPGTLQSVMY
SPVDVVTYAATPWKIIMTADTPGRLLENNDIVLNLNPEAESDFDWVKPGKIMRCTKLTTE
AAMEVIDFCAAHNIPYMLYDWKWYEPCTSHDGDATKVIPQIDMKKVVEYGREHGVGIWLY
INQHALQKQHKELLPVVAGWGVKGVKSGFVQYASHRWATWLHDLVREAADNKLMMNIHDE
FRPSGFSRTYPNLVTQEGILGNEEFPDATHNVTLPFTRMINGAADYTICYYDKRLKNSHA
HQLAASLVFYSPMQTIFWYDNPRMYKGEPEIKWFEDLETTFDDTKVLGGFPGRDIVMARR
KGDIWWVAAMVNNDGAKETIDLSFLEPGRKYVAEIYTDGDDKVKTATKVAMSTRKVTSKD
KLKFDVPGRGGVAMRIVPIR

Enzyme Prediction     

No EC number prediction in MGYG000003164_00084.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	9	616	9.5e-163	0.9873217115689382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14508	GH97_N	1.44e-58	24	277	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam10566	Glyco_hydro_97	5.28e-58	282	510	1	269	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14509	GH97_C	7.59e-37	521	617	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AND18133.1	0.0	6	619	11	629
QJR77933.1	0.0	6	618	11	628
QUT85427.1	0.0	6	619	11	629
QJR69441.1	0.0	6	619	11	629
QJR73774.1	0.0	6	619	11	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E1Q_A	6.77e-57	24	616	20	654	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3A24_A	5.14e-56	24	616	6	640	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
3WFA_A	1.92e-50	21	620	4	707	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	1.94e-50	21	620	13	716	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]
2D73_A	2.18e-50	21	620	24	727	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	5.69e-56	3	616	8	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	1.19e-49	21	620	24	727	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
D7CFN7	1.42e-40	40	613	59	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007033	0.991401	0.000524	0.000514	0.000276	0.000238

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003164_00084.