CAZyme Information: MGYG000003164_00696

Basic Information

• Species: CAG-485 sp002361235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp002361235
• CAZyme ID: MGYG000003164_00696
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294		33371.85	8.4208

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003164	2929430	MAG	United States	North America

• Gene Location: Start: 67488; End: 68372 Strand: +

Full Sequence      

MRFPSITLLIASITLYIASCRADSYNEYITLYSDMAVEQQELHGIPASITLAQGLLESAA
GRSTLAVKGNNHFGIKCHSSWTGDTLIRSDDRPDDCFRAYPDVRQSFDDHSRFLLRSRYA
SLFKLDPLDYASWARELKRCGYATDPNYASRLIAIIERYALYLYDTPEGRKADEDAAFIQ
ASLISTHPVRRARGLHYVIAAPGDTYTSIAREFKLDVKKLREFNDAGRHDKIKDWEEVYL
ESKLDDAPKHIDKAVIGERESMHSIAQRYGMKLSRLKALNPGVRDKAGATLRLR

Enzyme Prediction     

No EC number prediction in MGYG000003164_00696.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	35	161	2.7e-34	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.08e-36	28	178	46	201	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	3.89e-34	28	165	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	1.50e-26	34	161	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	3.53e-22	24	165	7	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	2.12e-17	45	167	340	474	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12398.1	1.53e-81	25	280	28	282
QCQ36508.1	3.65e-77	18	294	23	299
QLK82793.1	3.65e-77	18	294	23	299
AUI45961.1	3.65e-77	18	294	23	299
QRM70429.1	3.65e-77	18	294	23	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	3.83e-11	44	161	20	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	4.53e-11	44	161	21	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.98e-10	44	161	21	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	1.19e-09	45	174	80	221	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.06e-08	29	158	10	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	6.17e-15	23	177	46	212	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	1.46e-10	23	158	158	304	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P37710	5.39e-10	10	224	165	389	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9I4P4	9.72e-09	24	162	238	388	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
Q2G222	1.25e-08	45	165	340	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000486	0.583263	0.415692	0.000193	0.000176	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003164_00696.