CAZyme Information: MGYG000003164_00750

Basic Information

• Species: CAG-485 sp002361235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp002361235
• CAZyme ID: MGYG000003164_00750
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564	MGYG000003164_12|CGC1	61853.86	4.5857

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003164	2929430	MAG	United States	North America

• Gene Location: Start: 4705; End: 6399 Strand: -

Full Sequence      

MLLPGSCKSNDDNTPDNPVTSGFKVGVTELTFLKTAASQTFYVTAPSKPSVVSDALWLTV
GDIALNGASRSVYAVNVSVTDNDGYDDRTANLKITCGSGEATVSVTQRNADGVLLADGFT
APEVKAEGETIGIPVLATGEYTASVSDGWMEIVPAPVRSLSESKVYVKIGANYRNEAREG
SVTIALDSDNTKSVTVAVRQAATTSTGRCDETAFRTAANISMAINIGNTLEAIGGETAWG
AAKINEAYVNSIRESGFDAVRLPVAWYNHSDKNTLKIDENWMKRVDEVVQLCIANGLYVF
MNIHWDEGWMELNIDSYSSDVDRIQRELWTQIADRFKDYDKHLVFCGANEAGQDTQASAD
ALRAYMQTFIDVVRASGSNNANRVLVVQAPGTDIDRAVKYCVGNLPKDKVADRMMLEVHC
YDPSDFTILQNDGEWGANSKVRYFWGQDYHTGTDRDCTWGEENHIDTQMQKLKTNFVDNG
IPVIIGEFGCGRRRSFEATIDEAKHRASRCYYHSYIVKSAKTNGAVPFLWDTPNELFNRQ
TGDVIDPDNLAAMQQAATAASYPF

Enzyme Prediction     

No EC number prediction in MGYG000003164_00750.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	236	532	7.5e-91	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.22e-46	230	531	10	267	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.39e-16	225	489	56	322	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	4.90e-13	23	107	2	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
cd14948	BACON	6.57e-10	123	201	10	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam19190	BACON_2	3.93e-09	28	108	7	89	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD42340.1	1.12e-130	1	564	19	593
SCM57160.1	1.30e-115	6	564	23	566
SCD22090.1	1.02e-114	6	564	23	566
QQA29804.1	5.15e-109	6	564	26	593
QUT61324.1	1.44e-108	6	564	26	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OYC_A	1.56e-95	201	559	34	395	GH5endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYC_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107]
6HA9_A	1.22e-94	201	559	34	395	Structureof an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HA9_B Structure of an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_A Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_B Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107]
4W8A_A	2.66e-69	225	564	15	378	Crystalstructure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W8B_A Crystal structure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in complex with XXLG [uncultured bacterium]
3ZMR_A	1.01e-68	115	555	10	464	Bacteroidesovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus],3ZMR_B Bacteroides ovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus]
6WQY_A	2.63e-50	211	546	22	369	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT7	1.07e-67	115	555	45	499	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
O08342	4.70e-42	212	555	39	397	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P28623	3.44e-40	225	550	55	357	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P10477	2.54e-38	207	557	51	385	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P23660	4.74e-38	225	537	39	340	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999974	0.000071	0.000014	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003164_00750.