CAZyme Information: MGYG000003164_01014

Basic Information

• Species: CAG-485 sp002361235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp002361235
• CAZyme ID: MGYG000003164_01014
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	MGYG000003164_17|CGC2	68559.91	6.2138

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003164	2929430	MAG	United States	North America

• Gene Location: Start: 36214; End: 38037 Strand: -

Full Sequence      

MSAFMLAVSAYAERSVTIGDYVGDRINSCIENRVKCRNTALLVEPFRHLTEGSRWQTEFI
GKWMLGAIASYRYTDDKELLNKIKEAASDLMSTQREDGYIGNYKDADRLTNWDIWGRKYT
SLALLDYYSLTGDKKALKSVERLIDGLMDELKTRNVNIAETGLYRGMPSCSILEPVMYLY
QYTKKRKYLDFATEIVAAVEKPGSTRLVTKALENVPVAHRFDFPRKWWSYENGHKAYEMM
SCYVGLIEYGKAVGDGKFLAAAKAVAQNILDTEINVAGSGAAFECWYGGKDRQTIPAYHT
METCVTFTWMQLLDRLWRQTGDSKYADEFERTMYNALMASLRNDGKEISKYSPLEGRRQH
GEEQCGLPINCCNANGPRGFAMIPDFALRTGKDTLFVNLYMPLEAGLDVGKSRLNIKISN
DFPKTGNNKIEISRQGKDDVVLALRIPEWCDGKYCVSVDGCVIDRSTVKGYVTVPVERGT
TAITADFYLAGKIERLNGMQALTRGPLVFARDNRYNDGDVDECGVIKENENGEVDMKFLS
EGNEFAWCTAEVPMILGTDLEDSENSAGRKVKFCDFGSAGNDWSRDGRYRVWIVAPIHAM
SQPYHKY

Enzyme Prediction     

No EC number prediction in MGYG000003164_01014.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	31	510	3e-50	0.9465648854961832

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.55e-53	52	510	52	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.83e-45	36	510	42	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04792	LanM-like	0.003	47	197	524	681	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
COG1331	YyaL	0.004	63	219	415	578	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	7.64e-247	16	607	27	620
CEP77739.1	3.16e-35	8	520	17	546
ABR45039.1	1.35e-30	78	576	112	615
AST55952.1	1.35e-30	78	576	112	615
QUT97168.1	1.35e-30	78	576	112	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.53e-27	51	516	63	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
7EXU_A	3.67e-18	52	520	70	576	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRE_A	4.76e-18	52	520	70	576	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	4.85e-18	52	520	70	576	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRF_A	5.53e-16	52	520	70	576	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.61e-17	52	520	70	576	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.650475	0.347991	0.000448	0.000408	0.000324	0.000346

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003164_01014.