CAZyme Information: MGYG000003169_00304

Basic Information

• Species: UMGS1688 sp900544575
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; UMGS1688; UMGS1688 sp900544575
• CAZyme ID: MGYG000003169_00304
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
726	MGYG000003169_2|CGC1	83242.85	4.9878

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003169	1544132	MAG	United States	North America

• Gene Location: Start: 122205; End: 124385 Strand: -

Full Sequence      

MSVVFLAGRNLFHLTNGRFSYYVQIHPSGMLLNPYFGAYVEDIDVEQINPIGGHDWFSHY
YCHTDGKEKEYRDLYLNASPMVFPSSRAADVRPSAADINGARNNKLDFRYVSHRIYRGKP
SSEEMPFVRDSENEAETLEIIMCDFTKDVEVVLSLSVMPEYNAVIRNTEFVNKTEKALRL
ERAMSVTQDFPRADYDIIHFPGEWLFERQFRREALTEGTKVVAASSGRSSHEHNPFVMLA
DKEATETNGEVYAVSFLYSGSFKSEANVSKVGVTRLTMGIDDTHFGYEVKAGETFRFPEG
LIMYSGRGFEGISRQMHDLIRRNIIKDNNPAAYRSVLLNSWEGCYMDFDTEKTLALIAAA
KKTGVELFVLDDGWFGKRDDDFRSLGDWHVNEKKIDIARVAEECRKNGMKFGIWIEPEMA
NFDSDLLRAHPEYAAVDVASDPWLSRHQVMLDFANPEVVDAVYAQLEEVLGKYEIDYVKW
DHNRTLEDYFSPSLDPAHQDEFYYRNTLGYYRLADMLTKRFPDIHFQGCASGGGRFDLGT
LFYFPEIWTSDENDPVQRLFIQYGTSFAYPPCVMGAHINDNPVTCYRTKAEIALFGSYGF
ELDPRKMSAEEVAEVNAVTAIYKKFHDDVVLDGDLYRLISPFDGKAFAIDMVDKQKSKAL
FLFVNLLKKPRARRFVRLRGLNPWANYVNSLDNKVYSGDYYMKVGVNLSDVLGEFESRLV
TLEEVE

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	11	707	1.2e-209	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3345	GalA	4.01e-137	10	718	2	680	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	5.61e-136	294	633	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	2.32e-110	333	624	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	5.67e-74	29	290	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	2.01e-17	651	722	6	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABP66728.1	4.52e-170	1	726	1	729
QIQ33913.1	5.07e-169	1	724	1	727
AEM73871.1	1.01e-168	1	726	1	729
ADQ41327.1	2.01e-168	1	726	1	729
ACM59600.1	2.84e-168	1	726	1	729

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNQ_A	2.90e-166	1	726	1	728	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	1.02e-163	1	726	1	728	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2YFN_A	6.83e-162	1	725	1	720	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
4FNU_A	8.97e-162	1	726	1	728	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNT_A	1.27e-161	1	726	1	728	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ALJ4	5.57e-163	1	726	1	728	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G4T4R7	1.21e-158	1	726	1	721	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
G1UB44	5.31e-148	11	719	14	725	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	3.53e-142	1	705	1	710	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q92457	7.58e-134	83	724	93	744	Alpha-galactosidase 2 OS=Hypocrea jecorina OX=51453 GN=agl2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999984	0.000052	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003169_00304.